Rabbit AGK antibody
-
Catalog number70R-3532
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNeuroscience
-
ImmunogenAGK antibody was raised using the N terminal of AGK corresponding to a region with amino acids KKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGE
-
SpecificityAGK antibody was raised against the N terminal of AGK
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AGK antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolAGK-DT, AGK
-
Short nameRabbit AGK antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal AGK antibody raised against the N terminal of AGK
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetacylglycerol kinase, AGK and IDBG-44452 and ENSG00000006530 and 55750, acylglycerol kinase activity, Plasma membranes, Agk and IDBG-138799 and ENSMUSG00000029916 and 69923, AGK and IDBG-636479 and ENSBTAG00000019265 and 514693
-
Gene info
-
Identity
-
Gene
-
Long gene nameAGK divergent transcript
-
Locus
-
Discovery year2020-11-05
-
Entrez gene record
-
Classification
- Divergent transcripts
Gene info
-
Identity
-
Gene
-
Long gene nameacylglycerol kinase
-
Synonyms gene
-
Synonyms gene name
- multiple substrate lipid kinase
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2005-02-01
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data