Rabbit ADAT1 antibody
-
Catalog number70R-1343
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB, IHC
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenADAT1 antibody was raised using the C terminal of ADAT1 corresponding to a region with amino acids RLVPCGAAISWSAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELF
-
SpecificityADAT1 antibody was raised against the C terminal of ADAT1
-
Cross ReactivityHuman,Mouse,Rat,Dog
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ADAT1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolADAT1
-
Short nameRabbit ADAT1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ADAT1 antibody raised against the C terminal of ADAT1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetadenosine deaminase, tRNA-specific 1, HADAT1, ADAT1 and IDBG-42667 and ENSG00000065457 and 23536, metal ion binding, multiple, Adat1 and IDBG-193802 and ENSMUSG00000031949 and 30947, ADAT1 and IDBG-629163 and ENSBTAG00000015669 and 618521
-
Gene info
-
Identity
-
Gene
-
Long gene nameadenosine deaminase tRNA specific 1
-
GenBank acession
-
Locus
-
Discovery year1999-10-14
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Adenosine deaminases acting on RNA
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data