Rabbit ADARB1 antibody
-
Catalog number70R-1550
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI
-
SpecificityNA
-
Cross ReactivityHuman, Mouse, Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ADARB1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolADARB1
-
Short nameRabbit ADARB1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ADARB1 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetadenosine deaminase, RNA-specific, B1, ADAR2 and DRABA2 and DRADA2 and RED1, ADARB1 and IDBG-5701 and ENSG00000197381 and 104, metal ion binding, nuclei, Adarb1 and IDBG-166979 and ENSMUSG00000020262 and 110532, ADARB1 and IDBG-639626 and ENSBTAG00000017486 and 521761
-
Gene info
-
Identity
-
Gene
-
Long gene nameadenosine deaminase RNA specific B1
-
Synonyms gene name
- adenosine deaminase, RNA-specific, B1 (homolog of rat RED1)
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1996-10-02
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Adenosine deaminases acting on RNA
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data