Rabbit ADAR antibody
-
Catalog number70R-5881
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenADAR antibody was raised using the N terminal of ADAR corresponding to a region with amino acids GEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVS
-
SpecificityADAR antibody was raised against the N terminal of ADAR
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADAR antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolADAR
-
Short nameRabbit ADAR antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ADAR antibody raised against the N terminal of ADAR
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetadenosine deaminase, RNA-specific, ADAR1 and AGS6 and DRADA and DSH and DSRAD and G1P1 and IFI-4 and IFI4 and K88DSRBP and P136, ADAR and IDBG-102968 and ENSG00000160710 and 102724045,103, metal ion binding, nuclei, Adar and IDBG-164791 and ENSMUSG00000027951 and 56417, ADAR and IDBG-632405 and ENSBTAG00000007519 and 505134
-
Gene info
-
Identity
-
Gene
-
Long gene nameadenosine deaminase RNA specific
-
Synonyms gene
-
Synonyms gene name
- interferon-induced protein 4
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1995-12-12
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Adenosine deaminases acting on RNA
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data