Rabbit ADAM2 antibody

• Catalog number
  70R-6129
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Proteases, Inhibitors, & Enzymes
• Immunogen
  ADAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL
• Specificity
  NA
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADAM2 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  ADAM2  
• Gene symbol
  ADAM2
• Short name
  Rabbit ADAM2 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal ADAM2 antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  ADAM metallopeptidase domain 2, CRYN1 and CRYN2 and CT15 and FTNB and PH-30b and PH30 and PH30-beta, ADAM2 and IDBG-18630 and ENSG00000104755 and 2515, zinc ion binding, Extracellular, Adam2 and IDBG-174827 and ENSMUSG00000022039 and 11495, ADAM2 and IDBG-629478 and ENSBTAG00000009408 and 281599

Gene info

• Identity
  HGNC:198
• Gene
  ADAM2
• Long gene name
  ADAM metallopeptidase domain 2
• Synonyms gene
  • FTNB
• Synonyms gene name
  • fertilin beta
• Synonyms
  • PH-30b
  • PH30
  • CT15
• Synonyms name
  • cancer/testis antigen 15
• GenBank acession
  • U52370
• Locus
  8p11.22
• Discovery year
  1996-10-26
• Entrez gene record
  2515
• Pubmed identfication
  • 8702389
  • 9070941
• RefSeq identity
  • NM_001464
• Classification
  • ADAM metallopeptidase domain containing
• VEGA ID
  OTTHUMG00000164041

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products