Rabbit ADAM2 antibody
-
Catalog number70R-6129
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProteases, Inhibitors, & Enzymes
-
ImmunogenADAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL
-
SpecificityNA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADAM2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolADAM2
-
Short nameRabbit ADAM2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ADAM2 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetADAM metallopeptidase domain 2, CRYN1 and CRYN2 and CT15 and FTNB and PH-30b and PH30 and PH30-beta, ADAM2 and IDBG-18630 and ENSG00000104755 and 2515, zinc ion binding, Extracellular, Adam2 and IDBG-174827 and ENSMUSG00000022039 and 11495, ADAM2 and IDBG-629478 and ENSBTAG00000009408 and 281599
-
Gene info
-
Identity
-
Gene
-
Long gene nameADAM metallopeptidase domain 2
-
Synonyms gene
-
Synonyms gene name
- fertilin beta
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1996-10-26
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- ADAM metallopeptidase domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data