Rabbit ACVRL1 antibody

• Catalog number
  70R-7473
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  ACVRL1 antibody was raised using the N terminal of ACVRL1 corresponding to a region with amino acids SPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNH
• Specificity
  ACVRL1 antibody was raised against the N terminal of ACVRL1
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACVRL1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  ACVRL1  
• Gene symbol
  ACVRL1
• Short name
  Rabbit ACVRL1 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal ACVRL1 antibody raised against the N terminal of ACVRL1
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  activin A receptor type II-like 1, ACVRLK1 and ALK-1 and ALK1 and HHT and HHT2 and ORW2 and SKR3 and TSR-I, ACVRL1 and IDBG-33826 and ENSG00000139567 and 102723650,94, transforming growth factor beta receptor activity, Cell surfaces, Acvrl1 and IDBG-185502 and ENSMUSG00000000530 and 11482, BT.28710 and IDBG-632173 and ENSBTAG00000013843 and 534536

Gene info

• Identity
  HGNC:175
• Gene
  ACVRL1
• Long gene name
  activin A receptor like type 1
• Synonyms gene
  • ACVRLK1
  • ORW2
• Synonyms gene name
  • activin A receptor type II-like 1
  • activin A receptor type IL
• Synonyms
  • HHT2
  • ALK1
  • HHT
• Synonyms name
  • activin receptor-like kinase 1
• GenBank acession
  • L17075
• Locus
  12q13.13
• Discovery year
  1994-12-12
• Entrez gene record
  94
• Pubmed identfication
  • 8397373
  • 8640225
  • 22718755
• RefSeq identity
  • NM_000020
• Classification
  • Type 1 receptor serine/threonine kinases
• VEGA ID
  OTTHUMG00000169507
• Locus Specific Databases
  • Hereditary Hemorrhagic Telangiectasia (HHT) Mutation Database
  • LRG_543

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products