Rabbit ACP5 antibody

• Catalog number
  70R-3911
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  ACP5 antibody was raised using the N terminal of ACP5 corresponding to a region with amino acids DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ
• Specificity
  ACP5 antibody was raised against the N terminal of ACP5
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACP5 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  ACP5  
• Gene symbol
  ACP5
• Short name
  Rabbit ACP5 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal ACP5 antibody raised against the N terminal of ACP5
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  acid phosphatase 5, tartrate resistant, SPENCDI and TRAP, ACP5 and IDBG-29654 and ENSG00000102575 and 54, hydrolase activity, Plasma membranes, Acp5 and IDBG-143414 and ENSMUSG00000001348 and 11433, ACP5 and IDBG-643580 and ENSBTAG00000004826 and 517002

Gene info

• Identity
  HGNC:124
• Gene
  ACP5
• Long gene name
  acid phosphatase 5, tartrate resistant
• Synonyms
  • TRAP
  • HPAP
• Synonyms name
  • tartrate-resistant acid phosphatase
  • human purple acid phosphatase
• GenBank acession
  • X14618
• Locus
  19p13.2
• Discovery year
  1989-02-23
• Entrez gene record
  54
• Pubmed identfication
  • 8449511
  • 2338077
• Classification
  • Acid phosphatases
• VEGA ID
  OTTHUMG00000182036
• Locus Specific Databases
  • LRG_1218

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products