Rabbit ABCD2 antibody
-
Catalog number70R-6717
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenABCD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNELCKILGEDSVLKT
-
SpecificityNA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ABCD2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolABCD2
-
Short nameRabbit ABCD2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ABCD2 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetATP-binding cassette, sub-family D (ALD), member 2, ABC39 and ALDL1 and ALDR and ALDRP and hALDR, ABCD2 and IDBG-26995 and ENSG00000173208 and 225, ATPase activity, Plasma membranes, Abcd2 and IDBG-175455 and ENSMUSG00000055782 and 26874, BT.87418 and IDBG-633512 and ENSBTAG00000038043 and 100335783,101909154,526436
-
Gene info
-
Identity
-
Gene
-
Long gene nameATP binding cassette subfamily D member 2
-
Synonyms gene
-
Synonyms gene name
- ATP-binding cassette, sub-family D (ALD), member 2
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1997-10-10
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- ATP binding cassette subfamily D
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data