Rabbit A1CF antibody

• Catalog number
  70R-4765
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  DNA & RNA
• Immunogen
  A1CF antibody was raised using the N terminal of A1CF corresponding to a region with amino acids EAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGP
• Specificity
  A1CF antibody was raised against the N terminal of A1CF
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of A1CF antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  A1CF  
• Gene symbol
  A1CF
• Short name
  Rabbit A1CF antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal A1CF antibody raised against the N terminal of A1CF
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  APOBEC1 complementation factor, A1CF and IDBG-74457 and ENSG00000148584 and 29974, protein binding, nuclei, A1cf and IDBG-158361 and ENSMUSG00000052595 and 69865, A1CF and IDBG-637119 and ENSBTAG00000021195 and 100336715

Gene info

• Identity
  HGNC:24086
• Gene
  A1CF
• Long gene name
  APOBEC1 complementation factor
• Synonyms
  • ACF
  • ASP
  • ACF64
  • ACF65
  • APOBEC1CF
• GenBank acession
  • AF271790
• Locus
  10q11.23
• Discovery year
  2007-11-23
• Entrez gene record
  29974
• Pubmed identfication
  • 11815617
  • 11072063
• RefSeq identity
  • NM_014576
• Classification
  • RNA binding motif containing
• VEGA ID
  OTTHUMG00000018240

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products