PCDHAC1 antibody

• Catalog number
  70R-6120
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Cell Biology
• Type of Immunogen
  PCDHAC1 antibodies were raised using the N terminal of PCDHAC1 corresponding to a region with amino acids RVQALDPDEGSNGEVQYSLSNSTQAELRHRFHVHPKSGEVQVAASLGPPE
• Raised in
  Rabbit
• Specificity
  PCDHAC1 antibody was raised against the N terminal of PCDHAC1
• Cross Reactivity
  Human,Mouse,Rat
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDHAC1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  PCDHAC1 Blocking Peptide, catalog no. 33R-8254, is also available for use as a blocking control in assays to test for specificity of this PCDHAC1 antibody
• Additional Information
  This is a rabbit polyclonal antibody against PCDHAC1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  PCDHAC1  
• Gene symbol
  PCDHAC1
• Short name
  PCDHAC1 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal PCDHAC1 antibody raised against the N terminal of PCDHAC1
• Alternative technique
  antibodies
• Alternative to gene target
  protocadherin alpha subfamily C, 1, PCDHAC1 and IDBG-408709 and ENSG00000248383 and 56135, calcium ion binding, Plasma membranes, IDBG-646106 and IDBG-646106 and ENSBTAG00000046103 and

Gene info

• Identity
  HGNC:8676
• Gene
  PCDHAC1
• Long gene name
  protocadherin alpha subfamily C, 1
• Synonyms name
  • PCDH-ALPHA-C1
• GenBank acession
  • AF152473
• Locus
  5q31.3
• Discovery year
  2000-06-28
• Entrez gene record
  56135
• Pubmed identfication
  • 10380929
• RefSeq identity
  • NM_018898
• Classification
  • Clustered protocadherins
• VEGA ID
  OTTHUMG00000129603

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products