FAS antibody
-
Catalog number70R-3743
-
PricePlease ask
-
Size50 µg
-
-
CategoryPrimary Antibody
-
Antibody SubtypePolyclonal Antibodies, Purified
-
Area of researchImmunology
-
Type of ImmunogenFAS antibodies were raised using a synthetic peptide corresponding to a region with amino acids KKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
-
Raised inRabbit
-
Cross ReactivityHuman
-
Method of PurificationAffinity purified
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAS antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping conditionsBlue Ice
-
Tested forWB
-
Usage RecommendationsWB: 1 ug/ml
-
Assay InformationFAS Blocking Peptide, catalog no. 33R-4455, is also available for use as a blocking control in assays to test for specificity of this FAS antibody
-
Additional InformationThis is a rabbit polyclonal antibody against FAS, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolFAS-AS1, FASN, FAS
-
Short nameFAS antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameRabbit polyclonal FAS antibody
-
Alternative techniqueantibodies
-
Alternative to gene targetFas (TNF receptor superfamily, member 6), ALPS1A and APO-1 and APT1 and CD95 and FAS1 and FASTM and TNFRSF6, FAS and IDBG-81669 and ENSG00000026103 and 355, identical protein binding, nuclei, Fas and IDBG-159577 and ENSMUSG00000024778 and 14102, FAS and IDBG-637356 and ENSBTAG00000010785 and 282488
-
Gene info
-
Identity
-
Gene
-
Long gene nameFAS antisense RNA 1
-
Synonyms gene
-
Synonyms gene name
- FAS antisense RNA (non-protein coding)
- FAS antisense RNA 1 (non-protein coding)
-
Synonyms
-
Locus
-
Discovery year2009-07-16
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Antisense RNAs
Gene info
-
Identity
-
Gene
-
Long gene namefatty acid synthase
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1994-05-17
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Short chain dehydrogenase/reductase superfamily
- 7BS orphan methyltransferases
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameFas cell surface death receptor
-
Synonyms gene
-
Synonyms gene name
- tumor necrosis factor receptor superfamily, member 6
- Fas (TNF receptor superfamily, member 6)
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1992-06-25
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Tumor necrosis factor receptor superfamily
- Death inducing signaling complex
- CD molecules
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data