ASGR1 antibody

• Catalog number
  70R-2850
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Signal Transduction
• Type of Immunogen
  ASGR1 antibodies were raised using the N terminal of ASGR1 corresponding to a region with amino acids RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS
• Raised in
  Rabbit
• Specificity
  ASGR1 antibody was raised against the N terminal of ASGR1
• Cross Reactivity
  Human, Dog
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ASGR1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 0.5 ug/ml
• Additional Information
  This is a rabbit polyclonal antibody against ASGR1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  ASGR1  
• Gene symbol
  ASGR1
• Short name
  ASGR1 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal ASGR1 antibody raised against the N terminal of ASGR1
• Alternative technique
  antibodies
• Alternative to gene target
  asialoglycoprotein receptor 1, ASGPR and ASGPR1 and CLEC4H1 and HL-1, ASGR1 and IDBG-23366 and ENSG00000141505 and 432, metal ion binding, Extracellular, Asgr1 and IDBG-193435 and ENSMUSG00000020884 and 11889, ASGR1 and IDBG-634567 and ENSBTAG00000012071 and 509121

Gene info

• Identity
  HGNC:742
• Gene
  ASGR1
• Long gene name
  asialoglycoprotein receptor 1
• Synonyms
  • CLEC4H1
• Locus
  17p13.1
• Discovery year
  1988-05-24
• Entrez gene record
  432
• RefSeq identity
  • NM_001671
• Classification
  • C-type lectin domain containing
• VEGA ID
  OTTHUMG00000102159

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products