AIFM3 antibody

• Catalog number
  70R-2470
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Cell Cycle & Cell Death
• Type of Immunogen
  AIFM3 antibodies were raised using the middle region of AIFM3 corresponding to a region with amino acids EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL
• Raised in
  Rabbit
• Specificity
  AIFM3 antibody was raised against the middle region of AIFM3
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AIFM3 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  AIFM3 Blocking Peptide, catalog no. 33R-2429, is also available for use as a blocking control in assays to test for specificity of this AIFM3 antibody
• Additional Information
  This is a rabbit polyclonal antibody against AIFM3, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  AIFM3  
• Gene symbol
  AIFM3
• Short name
  AIFM3 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal AIFM3 antibody raised against the middle region of AIFM3
• Alternative technique
  antibodies
• Alternative to gene target
  apoptosis-inducing factor, mitochondrion-associated, 3, AIFM3 and IDBG-1846 and ENSG00000183773 and 150209, 2 iron, Cytoplasm, Aifm3 and IDBG-138951 and ENSMUSG00000022763 and 72168, AIFM3 and IDBG-637671 and ENSBTAG00000038132 and 526295

Gene info

• Identity
  HGNC:26398
• Gene
  AIFM3
• Long gene name
  apoptosis inducing factor mitochondria associated 3
• Synonyms gene name
  • apoptosis-inducing factor, mitochondrion-associated, 3
• Synonyms
  • AIFL
  • FLJ30473
• GenBank acession
  • AK094844
• Locus
  22q11.21
• Discovery year
  2006-11-16
• Entrez gene record
  150209
• Pubmed identfication
  • 15764604
• RefSeq identity
  • NM_144704
• VEGA ID
  OTTHUMG00000150804

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products