AHSG antibody

• Catalog number
  70R-5916
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Signal Transduction
• Type of Immunogen
  AHSG antibodies were raised using the N terminal of AHSG corresponding to a region with amino acids AQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL
• Raised in
  Rabbit
• Specificity
  AHSG antibody was raised against the N terminal of AHSG
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AHSG antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 0.25 ug/ml
• Assay Information
  AHSG Blocking Peptide, catalog no. 33R-1451, is also available for use as a blocking control in assays to test for specificity of this AHSG antibody
• Additional Information
  This is a rabbit polyclonal antibody against AHSG, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  AHSG  
• Gene symbol
  AHSG
• Short name
  AHSG antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal AHSG antibody raised against the N terminal of AHSG
• Alternative technique
  antibodies
• Alternative to gene target
  alpha-2-HS-glycoprotein, A2HS and AHS and FETUA and HSGA, AHSG and IDBG-68916 and ENSG00000145192 and 197, kinase inhibitor activity, Extracellular, Ahsg and IDBG-148706 and ENSMUSG00000022868 and 11625, AHSG and IDBG-634683 and ENSBTAG00000000522 and 280988

Gene info

• Identity
  HGNC:349
• Gene
  AHSG
• Long gene name
  alpha 2-HS glycoprotein
• Synonyms
  • FETUA
  • A2HS
  • HSGA
• Synonyms name
  • fetuin A
• GenBank acession
  • D67013
  • M16961
• Locus
  3q27.3
• Discovery year
  1986-01-01
• Entrez gene record
  197
• Pubmed identfication
  • 9322749
  • 7736783
• RefSeq identity
  • NM_001622
• Classification
  • Cystatins, type 4
• VEGA ID
  OTTHUMG00000156605

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products