ADH5 antibody

• Catalog number
  70R-3382
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Proteases, Inhibitors, & Enzymes
• Type of Immunogen
  ADH5 antibodies were raised using a synthetic peptide corresponding to a region with amino acids KSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSIRTVV
• Raised in
  Rabbit
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADH5 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  ADH5 Blocking Peptide, catalog no. 33R-4667, is also available for use as a blocking control in assays to test for specificity of this ADH5 antibody
• Additional Information
  This is a rabbit polyclonal antibody against ADH5, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  ADH5  
• Gene symbol
  ADH5
• Short name
  ADH5 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal ADH5 antibody
• Alternative technique
  antibodies
• Alternative to gene target
  alcohol dehydrogenase 5 (class III), chi polypeptide, ADH-3 and ADHX and FALDH and FDH and GSH-FDH and GSNOR, ADH5 and IDBG-31067 and ENSG00000197894 and 128, S-(hydroxymethyl)glutathione dehydrogenase activity, nuclei, Adh5 and IDBG-196598 and ENSMUSG00000028138 and 11532, ADH5 and IDBG-640968 and ENSBTAG00000016007 and 505515

Gene info

• Identity
  HGNC:253
• Gene
  ADH5
• Long gene name
  alcohol dehydrogenase 5 (class III), chi polypeptide
• Synonyms gene
  • FDH
• Synonyms gene name
  • formaldehyde dehydrogenase
• Synonyms
  • ADH-3
  • ADHX
  • GSNOR
• Synonyms name
  • S-nitrosoglutathione reductase
• GenBank acession
  • M29872
• Locus
  4q23
• Discovery year
  1986-01-01
• Entrez gene record
  128
• Pubmed identfication
  • 1446828
  • 6424546
• RefSeq identity
  • NM_000671
• Classification
  • Alcohol dehydrogenases
• VEGA ID
  OTTHUMG00000161230

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products