-
Target antigen
ANGPTL2
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human
-
Analyses
WB,IHC-P
-
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human ANGPTL2 (275-312aa WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD), different from the related mouse sequence by one amino acid.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the ANGPTL2 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The ANGPTL2 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Angiopoietin-related protein 2, also known as angiopoietin-like protein 2, is a protein that in humans is encoded by the ANGPTL2 gene. Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. ANGPTL2 protein is a secreted glycoprotein with homology to the angiopoietins and may exert a function on endothelial cells through autocrine or paracrine action.
-
Related articles
1. "Entrez Gene: ANGPTL2 angiopoietin-like 2". 2. Kim I, Moon SO, Koh KN, Kim H, Uhm CS, Kwak HJ, Kim NG, Koh GY (Oct 1999). "Molecular cloning, expression, and characterization of angiopoietin-related protein. angiopoietin-related protein induces endothelial cell sprouting". J Biol Chem. 274 (37): 26523–8. 3. Sun H, Zheng JM, Chen S, et al. (2007). "Enhanced expression of ANGPTL2 in the microvascular lesions of diabetic glomerulopathy". Nephron Exp. Nephrol.105 (4): e117–23.
-
Gene Name
ANGPTL2
-
Protein Name
Angiopoietin-related protein 2
-
Gene Full Name
angiopoietin like 2
-
Synonyms
AI593246 | Angptl2 | Arp2 | HARP | MGC8889 | UNQ170/PRO196 | Q9UKU9
-
Uniprot ID
Q9UKU9
-
Entrez GeneID
23452
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
