Adenylate Kinase 1 Antibody

• Catalog number
  PB10033
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  Adenylate Kinase 1
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human, mouse, rat
• Analyses
  WB
• Immunogen
  A synthetic peptide corresponding to a sequence at the C-terminus of human Adenylate Kinase 1 (149-189aa RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVF SQVCTH), different from the related mouse sequence by seven amino acids, and from the related rat sequence by four amino acids.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the Adenylate Kinase 1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The Adenylate Kinase 1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
• Related articles
  1. Bianchi, P., Zappa, M., Bredi, E., Vercellati, C., Pelissero, G., Barraco, F., Zanella, A. A case of complete adenylate kinase deficiency due to a nonsense mutation in AK-1 gene (arg107-to-stop, CGA-to-TGA) associated with chronic haemolytic anaemia. Brit. J. Haemat. 105: 75-79, 1999. 2. Qualtieri, A., Pedace, V., Bisconte, M. G., Bria, M., Gulino, B., Andreoli, V., Brancati, C. Severe erythrocyte adenylate kinase deficiency due to homozygous A-to-G substitution at codon 164 of human AK1 gene associated with chronic haemolytic anaemia. Brit. J. Haemat. 99: 770-776, 1997.
• Gene Name
  AK1
• Protein Name
  Adenylate kinase isoenzyme 1
• Gene Full Name
  adenylate kinase 1
• Synonyms
  Adenylate kinase 1 | AK 1 | AK1 | ATP-AMP transphosphorylase 1 | KAD1 | Myokinase | P00568
• Uniprot ID
  P00568
• Entrez GeneID
  203
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  Adenylate   Kinase  
• Gene symbol
  AK3, AK4, AK4P1
• Short name
  Adenylate Kinase 1 Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Adenylate phosphorylation catalyst 1 (antibody to-)
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:17376
• Gene
  AK3
• Long gene name
  adenylate kinase 3
• Synonyms gene
  • AK6
  • AK3L1
• Synonyms gene name
  • adenylate kinase 6
  • adenylate kinase 3 like 1
• Synonyms
  • AKL3L1
• GenBank acession
  • BC013771
• Locus
  9p24.1
• Discovery year
  2002-12-17
• Entrez gene record
  50808
• Pubmed identfication
  • 8288
  • 182062
• RefSeq identity
  • NM_016282
• Classification
  • Adenylate kinases
• VEGA ID
  OTTHUMG00000019472

Gene info

• Identity
  HGNC:363
• Gene
  AK4
• Long gene name
  adenylate kinase 4
• Synonyms gene
  • AK3
  • AK3L1
• Synonyms gene name
  • adenylate kinase 3
  • adenylate kinase 3-like 1
• GenBank acession
  • AK025926
• Locus
  1p31.3
• Discovery year
  2001-06-22
• Entrez gene record
  205
• Pubmed identfication
  • 11485571
• RefSeq identity
  • NM_013410
• Classification
  • Adenylate kinases
• VEGA ID
  OTTHUMG00000009033

Gene info

• Identity
  HGNC:364
• Gene
  AK4P1
• Long gene name
  adenylate kinase 4 pseudogene 1
• Synonyms gene
  • AK3P1
• Synonyms gene name
  • adenylate kinase 3 pseudogene 1
• GenBank acession
  • X60674
• Locus
  17q11.2
• Discovery year
  1992-06-24
• Entrez gene record
  206
• Pubmed identfication
  • 1639383
• RefSeq identity
  • NG_001070
• VEGA ID
  OTTHUMG00000179256

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products