CNTF, rat recombinant

#
  • Catalog number
    4019-1000
  • Price:

    Please ask

    Ask for price
  • Size
    1 mg
# #
  • Synonyms
    HCNTF, CNTF, Ciliary Neurotrophic Factor.
  • Alternative_names
    HCNTF, CNTF, Ciliary Neurotrophic Factor.
  • Description
    A potent neural factor promoting survivability and differentiation of neuronal cell types.
  • Recombinant
    Yes
  • Source
    E. coli
  • Purity by SDS PAGE
    ≥99%
  • Assay
    SDS-PAGE
  • Biological activity
    Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.
  • Molecular Weight
    22.834 kDa
  • Storage Temp
    -20°C
  • Shipping
    Gel pack
  • Shelf Life
    12 months
  • Appearance
    Lyophilized protein
  • Physical form description
    Lyophilized from 0.025 % NaHCO₃
  • Reconstitution Instructions
    Centrifuge the vial prior to opening. Reconstitute in sterile ddH₂O or 0.4 % NaHCO₃ adjusted to pH 8-9 to a concentration ≥ 100 µg/ml. This solution can then be diluted into other aqueous buffer, preferably in the presence of carrier protein.
  • Background Information
    CNTF is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. CNTF is a survival factor for various neuronal cell types and seems to prevent the degeneration of motor axons after axotomy. CNTF Recombinant Rat produced in E.Coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton. The CNTF is purified by proprietary chromatographic techniques.
  • Amino acid sequence
    AFAEQTPLTLHRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
  • Handling
    Centrifuge the vial prior to opening.
  • Usage
    For Research Use Only! Not to be used in humans
  • About
    Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
  • Latin name
    Rattus norvegicus
  • Additional source
    Recombinants or rec. proteins
  • Group
    recombinants
#
  • Gene target
    CNTF  
  • Gene symbol
    ZFP91-CNTF, CNTF
  • Short name
    CNTF, recombinant
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. Biovision advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    Rat
  • Species
    Rat, Rats
  • Alternative name
    ciliary neurotrophic factor, rat Rec.
  • Alternative technique
    rec
  • Alternative to gene target
    ciliary neurotrophic factor, HCNTF, CNTF and IDBG-409278 and ENSG00000242689 and 1270, growth factor activity, Extracellular, Cntf and IDBG-254935 and ENSMUSG00000079415 and 12803, CNTF and IDBG-637978 and ENSBTAG00000003624 and 100848228
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee