TIMP 1 (Native Protein)

  • Catalog number
    30 111 003
  • Price
    Please ask
  • Size
    200 µg/ 1 ml
  • Protein type
    Native
  • Protein subtype
    N/A
  • Protein family
    Natural inhibitor of the matrix metalloproteinases
  • Protein description
    TIMP1 is a metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. Mediates erythropoiesis in vitro; but, unlike IL3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors.
  • Research area interests
    Diseases associated with TIMP1 include Chronic Venous Leg Ulcers and Oral Submucous Fibrosis. Among its related pathways are p70S6K Signaling and CREB Pathway
  • Package form
    liquid
  • Tested applications
    TIMP1 is used to inhibit matrix metalloproteinases
  • Other names
    Tissue Inhibitor Of Metalloproteinases 1, Fibroblast Collagenase Inhibitor, Erythroid-Potentiating Activity
  • Peptide sequence
    MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
  • Available target modification
    Yes
  • Expression system
    human neutrophil granulocytes
  • Product Subtype
    full length
  • Active form
    No
  • Tag
    untagged
  • Contents
    50 mM Tris-HCl, pH 7, 200 mM NaCl, 5 mM CaCl2, 1 μM ZnCl2, 0.05%Brij 35, 0.05% NaN3
  • Protein purity
    >90%
  • Molecular weight
    28 kDa
  • UniProt number
    P01033
  • Gene number
    7076
  • Abbreviation
    TIMP1
  • Full name
    TIMP metallopeptidase inhibitor 1
  • Other desciption
    The human tissue inhibitor of matrix metalloproteinases TIMP-1 is expressed in Sf9 cells.
  • Purification
    Mentioned in the data sheet
  • PubMed citations
    See the data sheet
  • Warnings
    For Research Use only.
  • Shipping conditions
    dry ice
  • Storage condition
    Store at -70°C
  • Technical datasheet
    Contact us to receive the datasheet
  • Gene target
    TIMP   Native   Protein  
  • Gene symbol
    TIMP1
  • Short name
    TIMP 1 (Native Protein)
  • Species
    Homo sapiens
  • Alternative name
    TIMP 1 (Native Protein)
Gene info
  • Identity
  • Gene
  • Long gene name
    TIMP metallopeptidase inhibitor 1
  • Synonyms gene
  • Synonyms gene name
    • tissue inhibitor of metalloproteinase 1 (erythroid potentiating activity, collagenase inhibitor)
  • Synonyms
  • Locus
  • Discovery year
    1986-01-01
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Tissue inhibitor of metallopeptidases
  • VEGA ID
  • Locus Specific Databases
Similar products
Filters
Contact
Chat with gentaur.com employee