Recombinant Salmonella enterica OmpA family protein(A673_03341),partial

• Catalog number
  RPC20600
• Price
  Please ask
• Size
  20 μg

• Verified reactivity
  Salmonella enterica subsp. enterica serovar Enteritidis str. 2009K0958
• Protein number
  S4JJH7
• Gene number
  A673_03341
• Other name
  no alternative name
• Protein origin
  Mammalian cell
• Protein region
  82-220aa
• Protein sequence
  DVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGVDASRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSPLQ
• Information about sequence
  Partial
• Expected molecular weight
  20.32kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Salmonella   enterica   OmpA   family   protein   A673   03341   partial  
• Short name
  Recombinant Salmonella enterica OmpA family protein(A673_03341),partial
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Label
  N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Species
  Salmonella, Salmonellas
• Alternative name
  Rec. Salmonella enterica OmpA family protein(A673_03341),partial
• Alternative technique
  rec
• Disease
  Salmonella typhimurium, enteriditis and Salmonella paratyphi antibodies or media detect this rod-shaped (bacillus) gram-negative bacteria of the Enterobacteriaceae family. The two species of Salmonella are Salmonella enterica and Salmonella bongori. Salmonella enterica is the type species and is further divided into six subspecies that include over 2500 serovars. S. enterica subspecies are found worldwide in all warm-blooded animals, and in the environment. S. bongori is restricted to cold-blooded animals particularly reptiles. Strains of Salmonella cause illnesses such as typhoid fever, paratyphoid fever, and food poisoning (salmonellosis).

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products