Recombinant Rat Complement factor D (Cfd)

• Catalog number
  RPC20599
• Price
  Please ask
• Size
  100 μg

• Verified reactivity
  Rattus norvegicus (Rat)
• Protein number
  P32038
• Gene number
  Cfd
• Other name
  Adipsin; C3 convertase activator; Endogenous vascular elastase; Properdin factor D
• Protein origin
  Mammalian cell
• Protein region
  26-263aa
• Protein sequence
  ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA
• Information about sequence
  Full Length of Mature Protein
• Expected molecular weight
  31.31kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Description
  Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.
• About
  Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
• Latin name
  Rattus norvegicus
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Complement   factor   Cfd  
• Gene symbol
  CFD
• Short name
  Recombinant Complement factor D (Cfd)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  Rat
• Label
  N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Species
  Rat, Rats
• Alternative name
  Rec. Rat Complement factor D (complement factor D (adipsin))
• Alternative technique
  rec
• Alternative to gene target
  complement factor D (adipsin), ADIPSIN and ADN and DF and PFD, CFD and IDBG-13129 and ENSG00000197766 and 1675, serine-type peptidase activity, Extracellular, Cfd and IDBG-171424 and ENSMUSG00000061780 and 11537

Gene info

• Identity
  HGNC:2771
• Gene
  CFD
• Long gene name
  complement factor D
• Synonyms gene
  • DF
  • PFD
• Synonyms gene name
  • D component of complement (adipsin)
  • properdin factor D
  • complement factor D (adipsin)
• Synonyms
  • ADN
• Synonyms name
  • adipsin
• GenBank acession
  • M84526
• Locus
  19p13.3
• Discovery year
  1992-10-21
• Entrez gene record
  1675
• Pubmed identfication
  • 1374388
• RefSeq identity
  • NM_001928
• Classification
  • Granule associated serine proteases of immune defence
  • Complement system activation components
• VEGA ID
  OTTHUMG00000181840
• Locus Specific Databases
  • CFDbase: Mutation registry for Factor D deficiency (previously known as DFbase)
  • LRG_46

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products