Recombinant Rabbit Histidine triad nucleotide-binding protein 1(HINT1)

  • Catalog number
    RPC20602
  • Price
    Please ask
  • Size
    50 μg
  • Verified reactivity
    Oryctolagus cuniculus (Rabbit)
  • Protein number
    P80912 
  • Gene number
    HINT1
  • Other name
    Adenosine 5'-monophosphoramidase; P13.7
  • Protein origin
    Mammalian cell
  • Protein region
    2-126aa
  • Protein sequence
    ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG
  • Information about sequence
    Full Length
  • Expected molecular weight
    17.88kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • About
    Rabbits are used for polyclonal antibody production by bioma. Rabbit antibodies are very stable and can be stored for several days at room temperature. bioma adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    HINT1
  • Short name
    Recombinant Rabbit Histidine triad nucleotide-binding protein 1(HINT1)
  • Technique
    Recombinant, Rabbit, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    Rabbit, Rabbits
  • Label
    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Alternative name
    Rec. production species: rabbit Histidine triad nucleotide-binding protein 1(histidine triad nucleotide binding protein 1)
  • Alternative technique
    rec, rabbit-anti
  • Alternative to gene target
    histidine triad nucleotide binding protein 1, HINT and NMAN and PKCI-1 and PRKCNH1, HINT1 and IDBG-40323 and ENSG00000169567 and 3094, hydrolase activity, nuclei, Hint1 and IDBG-174166 and ENSMUSG00000020267 and 15254, HINT1 and IDBG-644750 and ENSBTAG00000010959 and 327693
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee