Recombinant Neisseria meningitidis serogroup B / serotype 15 Major outer membrane protein P.IB(porB)

  • Catalog number
    RPC20457
  • Price
    Please ask
  • Size
    200 μg
  • Verified reactivity
    Neisseria meningitidis serogroup B / serotype 15 (strain H44/76)
  • Protein number
    E6MZM0 
  • Gene number
    porB
  • Other name
    Class 3 protein; Porin
  • Protein origin
    E.coli
  • Protein region
    20-331aa
  • Protein sequence
    DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQEGLNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGLVDDADIGNEYDQVVVGAEYDFSKRTSALVSAGWLQEGKGENKFVATAGGVGLRHKF
  • Information about sequence
    Full Length of Mature Protein
  • Expected molecular weight
    50.63kD
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    Associated membrane protein types are lipopolysaccharide selective barriers. Biological membranes include cell membranes, outer coverings of cells or organelles that allow passage of certain proteins and nuclear membranes, which cover a cell nucleus; and tissue membranes, such as mucosae and serosae. 
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Neisseria meningitidis serogroup B / serotype 15 Major outer protein P IB(porB)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6XHis-SUMO-tagged
  • Alternative name
    Rec. Neisseria meningitidis serogroup B / serotype 15 Major outer membrane protein P.IB(porB)
  • Alternative technique
    rec
  • Disease
    neisseria
MeSH Data
  • Name
  • Concept
    Scope note: Radioimmunoassay of proteins using antibody coupled to an immunosorbent.
  • Tree numbers
    • E05.478.566.380.830
    • E05.478.566.639.830
    • E05.601.470.380.830
    • E05.601.470.639.830
  • Qualifiers
    ethics, mortality, psychology, trends, veterinary, history, classification, economics, instrumentation, methods, nursing, standards, adverse effects, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee