Recombinant Escherichia coli K99 fimbrial protein(fanC)

  • Catalog number
    RPC20557
  • Price
    Please ask
  • Size
    1 mg
  • Verified reactivity
    Escherichia coli
  • Protein number
    P18103
  • Gene number
    fanC
  • Other name
    no alternative name
  • Protein origin
    E.coli
  • Protein region
    23-181aa
  • Protein sequence
    NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM
  • Information about sequence
    Full Length of Mature Protein
  • Expected molecular weight
    33.65kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    Escherichia   coli   K99   fimbrial   protein   fanC  
  • Short name
    Recombinant Escherichia coli K99 fimbrial protein(fanC)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    Escherichia coli
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Alternative name
    Rec. Escherichia coli K99 fimbrial protein(fanC)
  • Alternative technique
    rec, escherichia
MeSH Data
  • Name
  • Concept
    Scope note: An in vitro allergen radioimmunoassay in which allergens are coupled to an immunosorbent. The coupled allergens bind the IgE in the sera of patients which in turn binds radioisotope-labeled anti-IMMUNOGLOBULIN E antibodies.
  • Tree numbers
    • E01.370.225.812.735.830
    • E05.200.812.735.830
    • E05.478.566.380.810
    • E05.478.566.639.810
    • E05.478.594.760.830
    • E05.601.470.380.810
    • E05.601.470.639.810
  • Qualifiers
    ethics, mortality, psychology, trends, veterinary, history, classification, economics, instrumentation, methods, nursing, standards, adverse effects, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee