Recombinant Chlamydia trachomatis Small cysteine-rich outer membrane protein OmcA(OmcA)

  • Catalog number
    RPC20395
  • Price
    Please ask
  • Size
    1 mg
  • Verified reactivity
    Chlamydia trachomatis
  • Protein number
    P0CC05
  • Gene number
    omcA
  • Other name
    9 kDa cysteine-rich lipoprotein; Short name:9kDa-CRP
  • Protein origin
    E.coli
  • Protein region
    19-88aa
  • Protein sequence
    CCRIVDCCFEDPCAPIQCSPCESKKKDVDGGCNSCNGYVPACKPCGGDTHQDAKHGPQARGIPVDGKCRQ
  • Information about sequence
    Full Length
  • Expected molecular weight
    23.7kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Gene
    Cys or cysteines ChEMBL54943
  • Description
    Associated membrane protein types are lipopolysaccharide selective barriers. Biological membranes include cell membranes, outer coverings of cells or organelles that allow passage of certain proteins and nuclear membranes, which cover a cell nucleus; and tissue membranes, such as mucosae and serosae. 
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Chlamydia trachomatis cysteine-rich outer protein OmcA(OmcA)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Species
    Chlamydia, Chlamydias
  • Alternative name
    Rec. Chlamydia trachomatis Small cysteine-rich outer membrane protein OmcA(OmcA)
  • Alternative technique
    rec
  • Disease
    chlamydia, Cervix, urethra an eye infection by Chlamydia trachomatis can form inclusion bodies in humans.
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee