Recombinant Chlamydia trachomatis Large cysteine-rich periplasmic protein OmcB(omcB),partial

• Catalog number
  RPC20358
• Price
  Please ask
• Size
  1 mg

• Verified reactivity
  Chlamydia trachomatis (strain D/UW-3/Cx)
• Protein number
  P0CC04
• Gene number
  omcB
• Other name
  Large-CRP; Alternative name(s):; 60 kDa cysteine-rich OMP; 60 kDa outer membrane protein; Cysteine-rich outer membrane protein; Short name:; CRP
• Protein origin
  E.coli
• Protein region
  41-196aa
• Protein sequence
  LADTKAKDNTSHKSKKARKNHSKETPVDRKEVAPVHESKATGPKQDSCFGRMYTVKVNDDRNVEITQAVPEYATVGSPYPIEITATGKRDCVDVIITQQLPCEAEFVRSDPATTPTADGKLVWKIDRLGQGEKSKITVWVKPLKEGCCFTAATVCA
• Information about sequence
  Partial
• Expected molecular weight
  33.16kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Gene
  Cys or cysteines ChEMBL54943
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Chlamydia   trachomatis   cysteine-rich   periplasmic   protein   OmcB   omcB   partial  
• Short name
  Recombinant Chlamydia trachomatis cysteine-rich periplasmic protein OmcB(omcB),partial
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Label
  N-terminal 6xHis-SUMO-tagged
• Species
  Chlamydia, Chlamydias
• Alternative name
  Rec. Chlamydia trachomatis large cysteine-rich periplasmic protein OmcB(omcB),partial
• Alternative technique
  rec
• Disease
  chlamydia, Cervix, urethra an eye infection by Chlamydia trachomatis can form inclusion bodies in humans.

MeSH Data

• Name
  Blood Grouping and Crossmatching
• Concept
  Scope note: Testing erythrocytes to determine presence or absence of blood-group antigens, testing of serum to determine the presence or absence of antibodies to these antigens, and selecting biocompatible blood by crossmatching samples from the donor against samples from the recipient. Crossmatching is performed prior to transfusion.
• Tree numbers
  • E01.370.225.625.120
  • E01.370.225.812.385.120
  • E05.200.625.120
  • E05.200.812.385.120
  • E05.478.594.385.120
• Qualifiers
  ethics, mortality, psychology, trends, veterinary, history, classification, economics, instrumentation, methods, nursing, standards, adverse effects, statistics & numerical data

Similar products