Recombinant Bovine Transforming growth factor beta-1(TGFB1),partial

  • Catalog number
    RPC20094
  • Price
    Please ask
  • Size
    1 mg
  • Verified reactivity
    Bos taurus (Bovine)
  • Protein number
    P18341
  • Gene number
    TGFB1
  • Other name
    no alternative name
  • Protein origin
    E.coli
  • Protein region
    279-390aa
  • Protein sequence
    ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
  • Information about sequence
    Partial
  • Expected molecular weight
    16.9kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    TGFB1
  • Short name
    Recombinant Transforming growth factor beta-1(TGFB1),partial
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-tagged
  • Species
    Bovine, Bos Taurus genes are available form the Bovine Genome database.
  • Alternative name
    Rec. Bovine Transforming growth factor b-1(transforming growth factor, b 1),partial
  • Alternative technique
    rec
  • Alternative to gene target
    transforming growth factor, beta 1, CED and DPD1 and LAP and TGFB and TGFbeta, TGFB1 and IDBG-52846 and ENSG00000105329 and 7040, protein N-terminus binding, nuclei, Tgfb1 and IDBG-158292 and ENSMUSG00000002603 and 21803, TGFB1 and IDBG-638417 and ENSBTAG00000020457 and 282089
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee