ATG5 Blocking Peptide

• Catalog number
  33R-7899
• Price
  Please ask
• Size
  100 ug

• Product Type
  Proteins
• Product Subtype
  Blocking Peptides
• Research Area
  Cell Biology
• Tag Conjugate
  RFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADG
• Type1
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Applications
  WB, IHC
• Shipping Info
  Blue Ice
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  ATG5  
• Gene symbol
  ATG5
• Short name
  ATG5 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  autophagy related 5 inhibiting short protein sequence
• Alternative technique
  control, peptides
• Alternative to gene target
  autophagy related 5, APG5 and APG5-LIKE and APG5L and ASP and hAPG5, ATG5 and IDBG-94856 and ENSG00000057663 and 9474, protein binding, Plasma membranes, Atg5 and IDBG-148568 and ENSMUSG00000038160 and 11793, ATG5 and IDBG-631895 and ENSBTAG00000005400 and 532686

Gene info

• Identity
  HGNC:589
• Gene
  ATG5
• Long gene name
  autophagy related 5
• Synonyms gene
  • APG5L
• Synonyms gene name
  • APG5 (autophagy 5, S. cerevisiae)-like
  • APG5 autophagy 5-like (S. cerevisiae)
  • ATG5 autophagy related 5 homolog (S. cerevisiae)
• Synonyms
  • ASP
  • APG5
  • hAPG5
• GenBank acession
  • Y11588
• Locus
  6q21
• Discovery year
  1999-09-16
• Entrez gene record
  9474
• Pubmed identfication
  • 9563500
  • 11349150
  • 15778222
• RefSeq identity
  • NM_004849
• Classification
  • Autophagy related
• VEGA ID
  OTTHUMG00000016193

Similar products