Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human Galectin 3 LGALS3

Recombinant Human Galectin 3 LGALS3 is available 8 times from Novo labs

C846-50 | Recombinant Human Galectin-3/LGALS3 (C-6His, Human Cells) size: 50 ug | 344.40 USD

Loading

C846-1000 | Recombinant Human Galectin-3/LGALS3 (C-6His, Human Cells) size: 1 mg | 1,896.47 USD

Loading

C846-500 | Recombinant Human Galectin-3/LGALS3 (C-6His, Human Cells) size: 500 ug | 1,264.32 USD

Loading

C846-10 | Recombinant Human Galectin-3/LGALS3 (C-6His, Human Cells) size: 10 ug | 160.87 USD

Loading

C068-500 | Recombinant Human Galectin-3/LGALS3 (E. coli) size: 500 ug | 764.71 USD

Loading

C068-50 | Recombinant Human Galectin-3/LGALS3 (E. coli) size: 50 ug | 218.65 USD

Loading

C068-1000 | Recombinant Human Galectin-3/LGALS3 (E. coli) size: 1 mg | 1,069.46 USD

Catalog number C068-1000
Supplier novo
Price 1,069.46 USD
Size 1 mg
Description Recombinant Human Galectin-3 is produced by our E.coli expression system and the target gene encoding Ala2-Ile250 is expressed.
Origin Escherichia coli
Peptide sequence ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Estimated molecular weight 26 kDa
Package form Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 2mM DTT,pH 7.4.
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Gene targetGalectin-3/LGALS3
Short name Recombinant Galectin-3/LGALS3 ( )
Host e. coli
Species E. coli
Alternative name Human Galectin-3/LGALS3
1. Gene info
Identity 6563
Gene LGALS3
Long gene name galectin 3
Synonyms gene
  • LGALS2
Synonyms gene name
  • lectin, galactoside-binding, soluble, 3
Synonyms
  • MAC-2
  • GALIG
Synonyms name
  • advanced glycation end-product receptor 3
GenBank acession
  • M64303
Locus 14q22.3
Discovery year 1991-09-13
Entrez gene record 3958
Pubmed identfication
  • 2009535
  • 8063692
RefSeq identity
  • NM_002306
Classification
  • Galectins
  • Receptor ligands
Havana BLAST/BLAT OTTHUMG00000171030
Product images
    #Human#.jpg

C068-10 | Recombinant Human Galectin-3/LGALS3 (E. coli) size: 10 ug | 114.42 USD

Loading
Species reactivity Human
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Ambient/Room Temperature
Reconstitution conditions See included datasheet or contact us for more information.
UniProt number P17931
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Technique Recombinant
Alternative technique rec
Similar products
Alms1 ELISA Kit| Mouse Alstrom syndrome protein 1 ELISA Kit Suppplier: Lifescience Market
Price: 780.57 USD
Rat Vitamin D Binding Protein ELISA Kit Suppplier: abbex
Price: 712.59 USD
USP15 siRNA Suppplier: abbex
Price: 672.94 USD
Monkey Aflatoxin B1 aldehyde reductase member ELISA Kit Suppplier: MyBioSource
Price: 644.62 USD
Chicken anti-golgiapparatusantibody(AGAA) ELISA Kit Suppplier: Enlibio
Price: 507.54 USD
KLHL38 Antibody - N-terminal region Suppplier: aviva
Price: 480.35 USD
Canine Sodium and chloride dependent transporter ELISA Kit Suppplier: MyBioSource
Price: 450.89 USD
Anti-RFTN2 antibody Suppplier: Lifescience Market
Price: 437.30 USD
Adenylate Cyclase Polyclonal Antibody Suppplier: Biomatik
Price: 402.18 USD
EIF4G1 Antibody Suppplier: EnoGene
Price: 334.21 USD
Human NKG2D ligand ELISA Kit Suppplier: MyBioSource
Price: 5.66 USD
Human Toll Like Receptor ELISA kit Suppplier: BlueGen ELISAs
Price: 1 438.78 USD
Recombinant Campylobacter Curvus panB Protein (aa 1-269) Suppplier: Creative Biolabs
Price: 1 609.85 USD
Recombinant Rat Renin receptor Atp6ap2 Suppplier: MyBioSource
Price: 1 377.61 USD
TG AB POS PLS BULK Suppplier: Seracare
Price: 0.00 USD
Ask
Ajax processing
Close
Recombinant Galectin-3/LGALS3 ( ) | Technique alternative |
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • Galectin-3/LGALS3
  • C-6His
  • Cells
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee