Recombinant Human Galectin-3/LGALS3 (E. coli)

• Catalog number
  C068-1000
• Price
  Please ask
• Size
  1 mg

• Description
  Recombinant Human Galectin-3 is produced by our E.coli expression system and the target gene encoding Ala2-Ile250 is expressed.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
• Estimated molecular weight
  26 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 2mM DTT,pH 7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  P17931
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Galectin-3/LGALS3  
• Gene symbol
  LGALS3
• Short name
  Recombinant Galectin-3/LGALS3 ( )
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  e. coli, Escherichia coli, Recombination of bioactive proteins and longer peptides in Escherichia Coli is done often with His tagging. novo supplies Rec. E. Coli affinity purified or tag purified antigens in 1 quantities or bulk volumes on request.
• Species
  E. coli, E. coli, Humans
• Alternative name
  Human Galectin-3/LGALS3
• Alternative technique
  rec, escherichia

Gene info

• Identity
  HGNC:6563
• Gene
  LGALS3
• Long gene name
  galectin 3
• Synonyms gene
  • LGALS2
• Synonyms gene name
  • lectin, galactoside-binding, soluble, 3
• Synonyms
  • MAC-2
  • GALIG
• Synonyms name
  • advanced glycation end-product receptor 3
• GenBank acession
  • M64303
• Locus
  14q22.3
• Discovery year
  1991-09-13
• Entrez gene record
  3958
• Pubmed identfication
  • 2009535
  • 8063692
• RefSeq identity
  • NM_002306
• Classification
  • Receptor ligands
  • Galectins
• VEGA ID
  OTTHUMG00000171030

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products