Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human Galectin 3 LGALS3

Recombinant Human Galectin 3 LGALS3 is available 8 times from Novo labs

C846-500 | Recombinant Human Galectin-3/LGALS3 (C-6His, Human Cells) size: 500 ug | 1,236.08 USD

Loading

C846-10 | Recombinant Human Galectin-3/LGALS3 (C-6His, Human Cells) size: 10 ug | 157.28 USD

Loading

C846-1000 | Recombinant Human Galectin-3/LGALS3 (C-6His, Human Cells) size: 1 mg | 1,854.12 USD

Loading

C846-50 | Recombinant Human Galectin-3/LGALS3 (C-6His, Human Cells) size: 50 ug | 336.71 USD

Loading

C068-1000 | Recombinant Human Galectin-3/LGALS3 (E. coli) size: 1 mg | 1,045.57 USD

Catalog number C068-1000
Supplier novo
Price 1,045.57 USD
Size 1 mg
Description Recombinant Human Galectin-3 is produced by our E.coli expression system and the target gene encoding Ala2-Ile250 is expressed.
Origin Escherichia coli
Peptide sequence ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Estimated molecular weight 26 kDa
Package form Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 2mM DTT,pH 7.4.
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Gene targetGalectin-3/LGALS3
Short name Recombinant Galectin-3/LGALS3 ( )
Host e. coli
Species E. coli
Alternative name recombinant H. sapiens Galectin-3/LGALS3 (E. coli)
1. Gene info
Identity6563
GeneLGALS3
Long gene namegalectin 3
Synonyms gene
Synonyms gene name
  • lectin, galactoside-binding, soluble, 3
Synonyms
GenBank acession
Locus14q22.3
Discovery year1991-09-13
Pubmed identfication
RefSeq identity
Havana BLAST/BLATOTTHUMG00000171030
MeSH Data
Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
Product images
    #Human#.jpg

C068-10 | Recombinant Human Galectin-3/LGALS3 (E. coli) size: 10 ug | 111.87 USD

Loading

C068-500 | Recombinant Human Galectin-3/LGALS3 (E. coli) size: 500 ug | 747.63 USD

Loading

C068-50 | Recombinant Human Galectin-3/LGALS3 (E. coli) size: 50 ug | 213.77 USD

Loading
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Species reactivity Human
Reconstitution conditions See included datasheet or contact us for more information.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
UniProt number P17931
Shipping condition Ambient/Room Temperature
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Technique Recombinant
Alternative technique rec
Similar products
Human CellExp GFER/HPO/ALR, human recombinant Suppplier: Biovision
Price: 592.57 USD
Human CellExpLAG3 CD223 human recombinant Suppplier: Biovision
Price: 387.66 USD
Human CellExp ErbB2 HER2 CD340 human recombinant Suppplier: Biovision
Price: 376.58 USD
Human CellExp CXADR CAR human recombinant Suppplier: Biovision
Price: 365.51 USD
Human CellExp CADM1 human recombinant Suppplier: Biovision
Price: 365.51 USD
Human CellExp CD55 DAF human recombinant Suppplier: Biovision
Price: 365.51 USD
Human CellExp CD84 SLAMF5 human recombinant Suppplier: Biovision
Price: 365.51 USD
Human CellExp CD319 SLAMF7 CRACC human recombinant Suppplier: Biovision
Price: 365.51 USD
Human CellExp CTLA4 CD152 human recombinant Suppplier: MyBioSource
Price: 0.00 USD
Human CellExp LEPR CD295 human recombinant Suppplier: MyBioSource
Price: 0.00 USD
Human CellExp SHH human recombinant Suppplier: MyBioSource
Price: 0.00 USD
Human CellExp Olfactomedin human recombinant Suppplier: MyBioSource
Price: 0.00 USD
Human CellExp TNFRSF4 OX40 CD134 human recombinant Suppplier: MyBioSource
Price: 0.00 USD
Human CellExp CD155 human recombinant Suppplier: MyBioSource
Price: 0.00 USD
Human CellExp DPPII QPP DPP7 human recombinant Suppplier: MyBioSource
Price: 0.00 USD
Ask
Ajax processing
Close
Recombinant Human Galectin-3/LGALS3 (E. coli) size: 1 mg
Filters
+32-(0)1-658-90-45 [email protected]
  • Galectin-3/LGALS3
  • C-6His
  • Cells
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee