Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human Interleukin 17F IL-17F

Recombinant Human Interleukin 17F IL-17F is available 12 times from Novo labs

C030-1000 | Recombinant Human Interleukin-17F/IL-17F size: 1 mg | 2,571.80 USD

Catalog number C030-1000
Supplier novo
Price 2,571.80 USD
Size 1 mg
Description Recombinant Human Interleukin-17F is produced by our E.coli expression system and the target gene encoding Arg31-Gln163 is expressed.
Origin Escherichia coli
Peptide sequence MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
Estimated molecular weight 30,1 kDa
Package form Lyophilized from a 0.2 µm filtered solution of 20mM PB, pH 7.4.
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Reconstitution conditions Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in 500mM Acetic Acid.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene targetInterleukin-17F/IL-17F
Short name Recombinant Interleukin-17F/IL-17F
Alternative name recombinant H. sapiens Interleukin-17F/Interleukin-17F
1. Gene info
Identity16404
GeneIL17F
Long gene nameinterleukin 17F
GenBank acession
Locus6p12.2
Discovery year2002-03-18
Pubmed identfication
RefSeq identity
Havana BLAST/BLATOTTHUMG00000014845
Locus Specific Databases
MeSH Data
Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
Product images
    #Human#.jpg

C030-10 | Recombinant Human Interleukin-17F/IL-17F size: 10 ug | 190.38 USD

Loading

C030-50 | Recombinant Human Interleukin-17F/IL-17F size: 50 ug | 457.36 USD

Loading

C030-500 | Recombinant Human Interleukin-17F/IL-17F size: 500 ug | 1,818.17 USD

Loading

CA22-1000 | Recombinant Human Interleukin-17F/IL-17F (C-6His) size: 1 mg | 2,571.80 USD

Loading

CA22-10 | Recombinant Human Interleukin-17F/IL-17F (C-6His) size: 10 ug | 176.86 USD

Loading

CA22-50 | Recombinant Human Interleukin-17F/IL-17F (C-6His) size: 50 ug | 416.81 USD

Loading

CA22-500 | Recombinant Human Interleukin-17F/IL-17F (C-6His) size: 500 ug | 1,818.17 USD

Loading

CS27-1000 | Recombinant Human Interleukin-17F/IL-17F (Human Cells) size: 1 mg | 2,571.80 USD

Loading

CS27-10 | Recombinant Human Interleukin-17F/IL-17F (Human Cells) size: 10 ug | 176.86 USD

Loading

CS27-50 | Recombinant Human Interleukin-17F/IL-17F (Human Cells) size: 50 ug | 416.81 USD

Loading

CS27-500 | Recombinant Human Interleukin-17F/IL-17F (Human Cells) size: 500 ug | 1,818.17 USD

Loading
Species reactivity Human
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Ambient/Room Temperature
UniProt number Q96PD4
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Technique Recombinant
Species Human
Alternative technique rec
Similar products
No similar products groups has been found
Ask
Ajax processing
Close
Recombinant Human Interleukin-17F/IL-17F size: 1 mg
Filters
+32-(0)1-658-90-45 [email protected]
  • Interleukin-17F/IL-17F
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee