Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human Interleukin 17F IL-17F

Recombinant Human Interleukin 17F IL-17F is available 12 times from Novo labs

C030-50 | Recombinant Human Interleukin-17F/IL-17F size: 50 ug | 457.81 USD

Loading

C030-500 | Recombinant Human Interleukin-17F/IL-17F size: 500 ug | 1,819.95 USD

Loading

C030-10 | Recombinant Human Interleukin-17F/IL-17F size: 10 ug | 190.56 USD

Loading

C030-1000 | Recombinant Human Interleukin-17F/IL-17F size: 1 mg | 2,574.31 USD

Catalog number C030-1000
Supplier novo
Price 2,574.31 USD
Size 1 mg
Description Recombinant Human Interleukin-17F is produced by our E.coli expression system and the target gene encoding Arg31-Gln163 is expressed.
Origin Escherichia coli
Peptide sequence MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
Estimated molecular weight 30,1 kDa
Package form Lyophilized from a 0.2 µm filtered solution of 20mM PB, pH 7.4.
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Reconstitution conditions Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in 500mM Acetic Acid.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene targetInterleukin-17F/IL-17F
Short name Recombinant Interleukin-17F/IL-17F
Alternative name Human IL-17F
1. Gene info
Identity 16404
Gene IL17F
Long gene name interleukin 17F
Synonyms
  • IL-17F
  • ML-1
  • ML1
GenBank acession
  • AF384857
Locus 6p12.2
Discovery year 2002-03-18
Entrez gene record 112744
Pubmed identfication
  • 11591732
  • 11591768
RefSeq identity
  • NM_052872
Classification
  • Interleukins
Havana BLAST/BLAT OTTHUMG00000014845
Locus Specific Databases
  • LRG_356
Product images
    #Human#.jpg

CA22-500 | Recombinant Human Interleukin-17F/IL-17F (C-6His) size: 500 ug | 1,819.95 USD

Loading

CA22-1000 | Recombinant Human Interleukin-17F/IL-17F (C-6His) size: 1 mg | 2,574.31 USD

Loading

CA22-50 | Recombinant Human Interleukin-17F/IL-17F (C-6His) size: 50 ug | 417.21 USD

Loading

CA22-10 | Recombinant Human Interleukin-17F/IL-17F (C-6His) size: 10 ug | 177.03 USD

Loading

CS27-50 | Recombinant Human Interleukin-17F/IL-17F (Human Cells) size: 50 ug | 417.21 USD

Loading

CS27-1000 | Recombinant Human Interleukin-17F/IL-17F (Human Cells) size: 1 mg | 2,574.31 USD

Loading

CS27-500 | Recombinant Human Interleukin-17F/IL-17F (Human Cells) size: 500 ug | 1,819.95 USD

Loading

CS27-10 | Recombinant Human Interleukin-17F/IL-17F (Human Cells) size: 10 ug | 177.03 USD

Loading
Species reactivity Human
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Ambient/Room Temperature
UniProt number Q96PD4
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Technique Recombinant
Species Human
Alternative technique rec
Similar products
Sheep T complex protein 1 subunit ELISA Kit Suppplier: MyBioSource
Price: 641.60 USD
Supreme C18 5 60 Reversed Phase C18 Column Suppplier: Separation Methods Technologies, Inc.
Price: 619.05 USD
Anti-CCDC117 (Polyclonal), ALEXA Fluor 594 Suppplier: Bioss Polyclonal Antibodies
Price: 551.40 USD
COL11A2 Suppplier: EnoGene
Price: 456.68 USD
PE Linked Polyclonal Antibody to Retinol Binding Protein Suppplier: MyBioSource
Price: 380.00 USD
SDF4 Polyclonal Antibody Suppplier: Biomatik
Price: 360.83 USD
SULT1B1 antibody N terminal region Suppplier: aviva
Price: 352.94 USD
CCNI Rabbit Polyclonal Antibody Suppplier: ELK Biotech
Price: 336.02 USD
LentimiRa mmu mir 2182 Suppplier: ABM microrna
Price: 285.28 USD
LentimiRa hsa miR 6777 Suppplier: ABM microrna
Price: 285.28 USD
Anti Ectonucleotide Pyrophosphatase Phosphodiesterase Antibody Suppplier: Cloud Clone Corp
Price: 274.01 USD
pCR4-TOPO-DMRT3 Suppplier: Lifescience Market
Price: 260.48 USD
MAGI3 3 UTR Lenti reporter Suppplier: ABM microrna
Price: 1 388.08 USD
4"-ETHYL-BIPHENYL-4-CARBONYL CHLORIDE Suppplier: SFC
Price: 0.00 USD
Ask
Ajax processing
Close
Recombinant Interleukin-17F/IL-17F | Technique alternative |
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • Interleukin-17F/IL-17F
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee