YWHAZ antibody

• Catalog number
  70R-3632
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Signal Transduction
• Type of Immunogen
  YWHAZ antibodies were raised using the middle region of Ywhaz corresponding to a region with amino acids FDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
• Raised in
  Rabbit
• Specificity
  YWHAZ antibody was raised against the middle region of Ywhaz
• Cross Reactivity
  Human,Mouse,Rat
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of YWHAZ antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  YWHAZ Blocking Peptide, catalog no. 33R-2862, is also available for use as a blocking control in assays to test for specificity of this YWHAZ antibody
• Additional Information
  This is a rabbit polyclonal antibody against YWHAZ, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  YWHAZ  
• Gene symbol
  YWHAZ
• Short name
  YWHAZ antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal YWHAZ antibody raised against the middle region of Ywhaz
• Alternative technique
  antibodies
• Alternative to gene target
  tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide, 14-3-3-zeta and HEL-S-3 and HEL4 and KCIP-1 and YWHAD, YWHAZ and IDBG-30919 and ENSG00000164924 and 7534, poly(A) RNA binding, nuclei, Ywhaz and IDBG-135418 and ENSMUSG00000022285 and 102641764,22631, YWHAZ and IDBG-645101 and ENSBTAG00000000236 and 287022

Gene info

• Identity
  HGNC:12855
• Gene
  YWHAZ
• Long gene name
  tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta
• Synonyms gene
  • YWHAD
• Synonyms gene name
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, delta polypeptide
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
• Synonyms
  • KCIP-1
  • 14-3-3-zeta
• Synonyms name
  • 14-3-3 zeta
  • 14-3-3 delta
• GenBank acession
  • U28964
• Locus
  8q22.3
• Discovery year
  1993-09-20
• Entrez gene record
  7534
• Pubmed identfication
  • 8617504
  • 7890696
• RefSeq identity
  • NM_145690
• Classification
  • 14-3-3 phospho-serine/phospho-threonine binding proteins
• VEGA ID
  OTTHUMG00000134291

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products