Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human Phosphatidylinositol 6His

Recombinant Human Phosphatidylinositol 6His is available 12 times from Novo labs

C921-50 | Recombinant Human Phosphatidylinositol 4-Kinase ß/PI4KB (C-6His) size: 50 ug | 582.83 USD

Loading

C921-500 | Recombinant Human Phosphatidylinositol 4-Kinase ß/PI4KB (C-6His) size: 500 ug | 1,892.74 USD

Loading

C921-1000 | Recombinant Human Phosphatidylinositol 4-Kinase ß/PI4KB (C-6His) size: 1 mg | 2,677.27 USD

Loading

C921-10 | Recombinant Human Phosphatidylinositol 4-Kinase ß/PI4KB (C-6His) size: 10 ug | 238.06 USD

Loading

CJ35-500 | Recombinant Human Phosphatidylinositol 5-Phosphate 4-Kinase 2a/PIP4K2A (C-6His) size: 500 ug | 1,892.74 USD

Loading

CJ35-50 | Recombinant Human Phosphatidylinositol 5-Phosphate 4-Kinase 2a/PIP4K2A (C-6His) size: 50 ug | 582.83 USD

Loading

CJ35-1000 | Recombinant Human Phosphatidylinositol 5-Phosphate 4-Kinase 2a/PIP4K2A (C-6His) size: 1 mg | 2,915.33 USD

Loading

CJ35-10 | Recombinant Human Phosphatidylinositol 5-Phosphate 4-Kinase 2a/PIP4K2A (C-6His) size: 10 ug | 238.06 USD

Loading

CE10-50 | Recombinant Human Phosphatidylinositol Transfer Protein a Isoform/PITPNA (N-6His) size: 50 ug | 582.83 USD

Loading

CE10-500 | Recombinant Human Phosphatidylinositol Transfer Protein a Isoform/PITPNA (N-6His) size: 500 ug | 1,892.74 USD

Catalog number CE10-500
Supplier novo
Price 1,892.74 USD
Size 500 ug
Description Recombinant Human PITPNA is produced by our E.coli expression system and the target gene encoding Met1-Asp270 is expressed with a 6His tag at the N-terminus.
Origin Escherichia coli
Peptide sequence MGSSHHHHHHSSGLVPRGSHMVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD
Estimated molecular weight 34 kDa
Shipping condition Dry Ice/ice packs
Package form Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 1mM EDTA, 1mM DTT, pH 8.0.
Storage conditions Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
UniProt number Q00169
Gene targetPhosphatidylinositol Transfer Protein Isoform/PITPNA N-6His
Short name Recombinant Phosphatidylinositol Transfer Protein a Isoform/PITPNA (N-6His)
Species Human
Alternative name Human PI-TP-Alpha/PITPNA(N-6His)
1. Gene info
Identity 9001
Gene PITPNA
Long gene name phosphatidylinositol transfer protein alpha
Synonyms gene
  • PITPN
Synonyms gene name
  • phosphotidylinositol transfer protein
Synonyms
  • VIB1A
GenBank acession
  • M73704
Locus 17p13.3
Discovery year 1994-03-24
Entrez gene record 5306
Pubmed identfication
  • 8255295
Classification
  • Phosphatidylinositol transfer proteins
Havana BLAST/BLAT OTTHUMG00000177779
Product images
    #Human#.jpg

CE10-1000 | Recombinant Human Phosphatidylinositol Transfer Protein a Isoform/PITPNA (N-6His) size: 1 mg | 2,677.27 USD

Loading

CE10-10 | Recombinant Human Phosphatidylinositol Transfer Protein a Isoform/PITPNA (N-6His) size: 10 ug | 238.06 USD

Loading
Species reactivity Human
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Reconstitution conditions Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Technique Recombinant
Alternative technique rec
Similar products
Mouse Claudin 3 CLDN3 ELISA Kit Suppplier: Reddot Biotech
Price: 953.41 USD
Interleukin 17E Human Suppplier: genways
Price: 678.99 USD
Mouse BH3 Interacting Domain Death Agonist Bid ELISA Kit Suppplier: Cloud Clone Corp
Price: 637.95 USD
Mouse Lysyl oxidase homolog 1 LOXL1 ELISA Kit Suppplier: abebio
Price: 449.14 USD
Bovine Pepsin(PP) ELISA Kit Suppplier: MyBioSource
Price: 447.97 USD
FOXO4 (Ab-451) Antibody Suppplier: EnoGene
Price: 439.76 USD
CABP5 3 UTR Lenti reporter Suppplier: ABM microrna
Price: 418.65 USD
KDM1A Antibody Suppplier: MBS Monoclonals
Price: 350.64 USD
LentimiRa Off mmu miR 1948 Suppplier: ABM microrna
Price: 296.69 USD
KRT20 Antibody Suppplier: Elabscience
Price: 126.60 USD
Recombinant Acidovorax ebreus Adenylate kinase adk Suppplier: MyBioSource
Price: 5.86 USD
Sheep Phospholipase A2 ELISA Kit Suppplier: MyBioSource
Price: 5.86 USD
Ropivacaine[Ropivacaine] Suppplier: MyBioSource
Price: 5.86 USD
Pig Histone H1t(HIST1H1T) ELISA kit Suppplier: BlueGen ELISAs
Price: 1 489.33 USD
4-Boc-3-Carboxymethylmorpholine Suppplier: SFC
Price: 0.00 USD
Pls3 3 UTR Luciferase Stable Cell Line Suppplier: ABM microrna
Price: 0.00 USD
Ask
Ajax processing
Close
Recombinant Phosphatidylinositol Transfer Protein a Isoform/
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • Phosphatidylinositol
  • 4-Kinase
  • ß/PI4KB
  • C-6His
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee