Recombinant Human TRAIL R3/TNFRSF10C/CD263 (C-Fc-6His)

  • Catalog number
    CD17-50
  • Price
    Please ask
  • Size
    50 ug
  • Description
    Recombinant Human TRAIL receptor 3 is produced by our Mammalian expression system and the target gene encoding Ala26-Ala221 is expressed with a Fc, 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
  • Estimated molecular weight
    48,7 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    O14798
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    TNFRSF10C, TNFSF10, TNFRSF10B
  • Short name
    Recombinant TRAIL R3/TNFRSF10C/CD263 (C-Fc-6His)
  • Technique
    Recombinant, FC, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human TRAIL R3/TNFRSF10C/CD263(C-Fc-6His)
  • Alternative technique
    rec
  • Alternative to gene target
    tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain, CD263 and DCR1 and DCR1-TNFR and LIT and TRAIL-R3 and TRAILR3 and TRID, TNFRSF10C and IDBG-11572 and ENSG00000173535 and 8794, TRAIL binding, Plasma membranes
Gene info
  • Identity
  • Gene
  • Long gene name
    TNF receptor superfamily member 10c
  • Synonyms gene name
    • tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1998-12-04
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • CD molecules
    • Tumor necrosis factor receptor superfamily
  • VEGA ID
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee