Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human TRAIL C

Recombinant Human TRAIL C is available 21 times from Novo labs

C326-50 | Recombinant Human TRAIL R2/TNFRSF10B/DR5/CD262 (C-6His) size: 50 ug | 192.18 USD

Loading

C326-1000 | Recombinant Human TRAIL R2/TNFRSF10B/DR5/CD262 (C-6His) size: 1 mg | 1,303.89 USD

Loading

C326-10 | Recombinant Human TRAIL R2/TNFRSF10B/DR5/CD262 (C-6His) size: 10 ug | 101.67 USD

Loading

CD31-10 | Recombinant Human TRAIL R2/TNFRSF10B/DR5/CD262 (C-Fc-6His) size: 10 ug | 112.85 USD

Loading

CD31-1000 | Recombinant Human TRAIL R2/TNFRSF10B/DR5/CD262 (C-Fc-6His) size: 1 mg | 1,020.09 USD

Loading

CD31-50 | Recombinant Human TRAIL R2/TNFRSF10B/DR5/CD262 (C-Fc-6His) size: 50 ug | 226.81 USD

Loading

CD31-500 | Recombinant Human TRAIL R2/TNFRSF10B/DR5/CD262 (C-Fc-6His) size: 500 ug | 793.28 USD

Loading

C504-10 | Recombinant Human TRAIL R3/TNFRSF10C/CD263 (C-6His) size: 10 ug | 101.67 USD

Catalog number C504-10
Supplier novo
Price 101.67 USD
Size 10 ug
Description Recombinant Human TRAIL receptor 3 is produced by our Mammalian expression system and the target gene encoding Ala26-Ala221 is expressed with a 6His tag at the C-terminus.
Origin Human cells
Peptide sequence ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAVDHHHHHH
Estimated molecular weight 21,78 kDa
Package form Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
UniProt number O14798
Gene targetTRAIL R3/TNFRSF10C/CD263 C-6His
Short name Recombinant TRAIL R3/TNFRSF10C/CD263 (C-6His)
Technique Recombinant
Alternative name recombinant H. sapiens TRAIL R3/tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain/CD263 (C-6His)
Alternative to gene target tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain, CD263 and DCR1 and DCR1-TNFR and LIT and TRAIL-R3 and TRAILR3 and TRID, TNFRSF10C and IDBG-11572 and ENSG00000173535 and 8794, TRAIL binding, Plasma membranes
1. Gene info
Identity 11906
Gene TNFRSF10C
Long gene name TNF receptor superfamily member 10c
Synonyms gene name
  • tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain
Synonyms
  • DcR1
  • TRAILR3
  • LIT
  • TRID
  • CD263
GenBank acession
  • AF012536
Locus 8p21.3
Discovery year 1998-12-04
Entrez gene record 8794
Pubmed identfication
  • 9314565
  • 9325248
Classification
  • CD molecules
  • Tumor necrosis factor receptor superfamily
Havana BLAST/BLAT OTTHUMG00000097844
2. Gene info
Identity 11925
Gene TNFSF10
Long gene name TNF superfamily member 10
Synonyms gene name
  • tumor necrosis factor (ligand) superfamily, member 10
Synonyms
  • TRAIL
  • Apo-2L
  • TL2
  • CD253
GenBank acession
  • U37518
Locus 3q26
Discovery year 1998-12-04
Pubmed identfication
  • 8777713
  • 8663110
Classification
  • Tumor necrosis factor superfamily
  • CD molecules
Havana BLAST/BLAT OTTHUMG00000156917
MeSH Data
Name Flow Cytometry
Tree numbers
  • E01.370.225.500.363.342
  • E01.370.225.500.386.350
  • E05.196.712.516.600.240.350
  • E05.200.500.363.342
  • E05.200.500.386.350
  • E05.242.363.342
  • E05.242.386.350
Product images
    #Human#.jpg

C504-50 | Recombinant Human TRAIL R3/TNFRSF10C/CD263 (C-6His) size: 50 ug | 192.18 USD

Loading

C504-1000 | Recombinant Human TRAIL R3/TNFRSF10C/CD263 (C-6His) size: 1 mg | 1,303.89 USD

Loading

CD17-50 | Recombinant Human TRAIL R3/TNFRSF10C/CD263 (C-Fc-6His) size: 50 ug | 226.81 USD

Loading

CD17-1000 | Recombinant Human TRAIL R3/TNFRSF10C/CD263 (C-Fc-6His) size: 1 mg | 1,020.09 USD

Loading

CU11-1000 | Recombinant Human TRAIL R4/TNFRSF10D/CD264 (C-Fc) size: 1 mg | 1,134.06 USD

Loading

CU11-500 | Recombinant Human TRAIL R4/TNFRSF10D/CD264 (C-Fc) size: 500 ug | 810.04 USD

Loading

CU11-50 | Recombinant Human TRAIL R4/TNFRSF10D/CD264 (C-Fc) size: 50 ug | 226.81 USD

Loading

CU11-10 | Recombinant Human TRAIL R4/TNFRSF10D/CD264 (C-Fc) size: 10 ug | 136.31 USD

Loading

C022-50 | Recombinant Human TRAIL/TNFSF10/CD253 (Arg115-Gly281) size: 50 ug | 215.64 USD

Loading

C022-500 | Recombinant Human TRAIL/TNFSF10/CD253 (Arg115-Gly281) size: 500 ug | 754.18 USD

Loading

C022-10 | Recombinant Human TRAIL/TNFSF10/CD253 (Arg115-Gly281) size: 10 ug | 112.85 USD

Loading

C022-1000 | Recombinant Human TRAIL/TNFSF10/CD253 (Arg115-Gly281) size: 1 mg | 1,054.73 USD

Loading

CG92-50 | Recombinant Human TRAIL/TNFSF10/CD253 (Val114-Gly281, C-6His) size: 50 ug | 175.42 USD

Loading
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Species reactivity Human
Reconstitution conditions See included datasheet or contact us for more information.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Ambient/Room Temperature
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Species Human
Alternative technique rec
Similar products
TRAIL-R3, Human Recombinant Protein Suppplier: Kamiya
Price: 653.62 USD
Human CellExp GFER/HPO/ALR, human recombinant Suppplier: Biovision
Price: 597.76 USD
Human CellExpLAG3 CD223 human recombinant Suppplier: Biovision
Price: 391.06 USD
Human CellExp ErbB2 HER2 CD340 human recombinant Suppplier: Biovision
Price: 379.88 USD
Human CellExp CD84 SLAMF5 human recombinant Suppplier: Biovision
Price: 368.71 USD
Human CellExp TNFRSF10B TRAILR2 human recombinant Suppplier: Biovision
Price: 368.71 USD
Human CellExp CD319 SLAMF7 CRACC human recombinant Suppplier: Biovision
Price: 368.71 USD
Human CellExp CD55 DAF human recombinant Suppplier: Biovision
Price: 368.71 USD
Human CellExp TNFRSF10A TRAIL R1 human recombinant Suppplier: Biovision
Price: 251.39 USD
Human CellExp Olfactomedin human recombinant Suppplier: MyBioSource
Price: 0.00 USD
Human CellExp TNFRSF10A TRAIL R1 human recombinant Suppplier: MyBioSource
Price: 0.00 USD
Human CellExp TNFRSF4 OX40 CD134 human recombinant Suppplier: MyBioSource
Price: 0.00 USD
Human CellExp CD155 human recombinant Suppplier: MyBioSource
Price: 0.00 USD
Human CellExp LEPR CD295 human recombinant Suppplier: MyBioSource
Price: 0.00 USD
Human CellExp TNFRSF10B TRAILR2 human recombinant Suppplier: MyBioSource
Price: 0.00 USD
Human CellExp SHH human recombinant Suppplier: MyBioSource
Price: 0.00 USD
Ask
Ajax processing
Close
Recombinant Human TRAIL R3/TNFRSF10C/CD263 (C-6His) size: 10
Filters
+32-(0)1-658-90-45 [email protected]
  • TRAIL
  • R2/TNFRSF10B/DR5/CD262
  • C-6His
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee