-
Target antigen
RENT1/hUPF1
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human
-
Analyses
WB,IHC-P
-
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human RENT1/hUPF1 (578-614aa NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE), identical to the related mouse and rat sequences.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the RENT1/hUPF1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The RENT1/hUPF1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Regulator of nonsense transcripts 1 is a protein that in humans is encoded by the UPF1 gene. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. And this protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. Alternative splicing results in multiple transcript variants.
-
Related articles
1. "Entrez Gene: UPF1 UPF1 regulator of nonsense transcripts homolog (yeast)". 2. Applequist SE, Selg M, Raman C, Jack HM (March 1997). "Cloning and characterization of HUPF1, a human homolog of the Saccharomyces cerevisiae nonsense mRNA-reducing UPF1 protein". Nucleic Acids Res 25 (4): 814–21. 3. Perlick HA, Medghalchi SM, Spencer FA, Kendzior RJ Jr, Dietz HC (November 1996). "Mammalian orthologues of a yeast regulator of nonsense transcript stability". Proc Natl Acad Sci U S A 93 (20): 10928–32.
-
Gene Name
UPF1
-
Protein Name
Regulator of nonsense transcripts 1
-
Gene Full Name
UPF1 regulator of nonsense transcripts homolog (yeast)
-
Synonyms
ATP dependent helicase RENT1 antibody|ATP-dependent helicase RENT1 antibody|Delta helicase antibody|FLJ43809 antibody|FLJ46894 antibody|HUPF 1 antibody|hUpf1 antibody|KIAA0221 antibody|Nonsense mRNA reducing factor 1 antibody|NORF 1 antibody|NORF1 antibody| pNORF 1 antibody|pNORF1 antibody|Regulator of nonsense transcripts 1 antibody|RENT 1 antibody|RENT1 antibody|RENT1_HUMAN antibody|Smg 2 antibody|Smg 2 homolog nonsense mediated mRNA decay factor antibody|UP Frameshift 1 antibody|Up frameshift mutation 1 homolog (S. cerevisiae) antibody|Up frameshift mutation 1 homolog antibody|Up frameshift suppressor 1 homolog antibody|Up-frameshift suppressor 1 homolog antibody|UPF 1 antibody|UPF 1 regulator of nonsense transcripts homolog antibody|upf1 antibody|UPF1 regulator of nonsense transcripts homolog antibody|Yeast Upf1p homolog antibody
-
Uniprot ID
Q92900
-
Entrez GeneID
5976
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
