Recombinant Toxocara canis 26 kDa secreted antigen(TES-26)

  • Catalog number
    RPC20259
  • Price
    Please ask
  • Size
    200 μg
  • Verified reactivity
    Toxocara canis (Canine roundworm)
  • Protein number
    P54190
  • Gene number
    TES-26
  • Other name
    Toxocara excretory-secretory antigen 26 ; TES-26
  • Protein origin
    Yeast
  • Protein region
    22-262aa
  • Protein sequence
    QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
  • Information about sequence
    Full Length
  • Expected molecular weight
    27.9kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    Antigens are peptides or recombinant or native dependent on the production method. The kilo Daltons subunit weight of Recombinant Toxocara canis 26 secreted antigen(TES-26) compared to your protein ladder can be shifted a little due to electrophoresis effects. 1 kDa = 1000 g/mol protein
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    SNORD116-26, SNORD114-26, SNORD115-26, RNVU1-26, ERVW-26, IGKV2D-26, ERVK-26, IGHV2-26, DLX2, IGLV3-26
  • Short name
    Recombinant Toxocara canis 26 secreted antigen(TES-26)
  • Technique
    Recombinant, antigen, antigenes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-tagged
  • Alternative name
    Rec. Toxocara canis 26 kiloDalton secreted protein(TES-26)
  • Alternative technique
    rec, antigenes
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    RNA, variant U1 small nuclear 26
  • Locus
  • Discovery year
    2019-07-26
  • Classification
    • Variant U1 small nuclear RNAs
Gene info
  • Identity
  • Gene
  • Long gene name
    endogenous retrovirus group W member 26
  • Synonyms gene name
    • endogenous retrovirus group W, member 26
  • GenBank acession
  • Locus
  • Discovery year
    2013-10-21
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    endogenous retrovirus group K member 26
  • Synonyms gene name
    • endogenous retrovirus group K, member 26
  • GenBank acession
  • Locus
  • Discovery year
    2014-01-03
  • Pubmed identfication
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    distal-less homeobox 2
  • Synonyms gene name
    • distal-less homeo box 2
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1992-05-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • NKL subclass homeoboxes and pseudogenes
  • VEGA ID
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin lambda variable 3-26 (pseudogene)
  • Synonyms gene name
    • immunoglobulin lambda variable 3-26
    • immunoglobulin lambda variable 3-26 pseudogene
  • GenBank acession
  • Locus
  • Discovery year
    2000-05-08
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Immunoglobulin lambda locus at 22q11.2
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee