Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

alpha1- Antitrypsin (Native Protein)

alpha1- Antitrypsin (Native Protein) is available 0 time from Biotez labs

Abbreviation SERPINA1
Expression system Human Blood
Other names Serpin Family A Member 1, Serpin Peptidase Inhibitor, Clade A,
Protein subtype N/A
Protein description SERPIN1's primary target is elastase, but it also has a moderate affinity for plasmin and thrombin. Irreversibly inhibits trypsin, chymotrypsin and plasminogen activator. The aberrant form inhibits insulin-induced NO synthesis in platelets, decreases coagulation time and has proteolytic activity against insulin and plasmin. Short peptide from AAT: reversible chymotrypsin inhibitor. It also inhibits elastase, but not trypsin. Its major physiological function is the protection of the lower respiratory tract against proteolytic destruction by human leukocyte elastase (HLE).
Product Subtype full length
Molecular weight 54 kDa
Gene number 5265
Package form liquid
Storage condition Store at -70°C
Tested applications inhibitor of proteases
Full name serpin family A member 1
Shipping conditions cool packs or dry ice
Purification Mentioned in the data sheet
Research area interests Diseases associated with SERPINA1 include Emphysema Due To Aat Deficiency and Hemorrhagic Disease Due To Alpha-1-Antitrypsin Pittsburgh Mutation. Among its related pathways are Platelet activation, signaling and aggregation and FOXA1 transcription factor network.
Other desciption Purified from human serum.
Peptide sequence MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
Technical datasheet Contact us to receive the datasheet
Active form? Yes
Contents 50mM phosphate buffer pH 6.5; 100mM NaCl, without BSA and Azide
Available target modification No
Protein purity >95%
Protein family Inhibitor of serine proteases, Member of Serpin Family
Tag untagged
UniProt number P01009
PubMed citations See the data sheet
Warnings For Research Use only.
Protein type Native
Short name alpha1- Antitrypsin (Native Protein)
Alternative name alpha1- Antitrypsin (Native Protein)
Alternative technique antibodies
Similar products
a1 Antitrypsin AAT inhibitor alpha1 PI alpha1 proteinase Suppplier: MBS Polyclonals
Price: 330.65 USD
Sheep alpha1-AGP (Alpha-1-Acid Glycoprotein) ELISA Kit Suppplier: MyBioSource
Price: 666.94 USD
Sheep alpha1-AT (Alpha 1-Antitrypsin) ELISA Kit Suppplier: MyBioSource
Price: 666.94 USD
Human alpha1 AGP Alpha 1 Acid Glycoprotein Kit Suppplier: MyBioSource
Price: 567.64 USD
Sheep anti human alpha1Antitrypsin alpha1AT IgG Suppplier: MBS Polyclonals
Price: 343.06 USD
Ask
Ajax processing
Close
alpha1- Antitrypsin (Native Protein) - Gentaur.com
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Contact us
Ajax processing
Close
Chat with gentaur.com employee