FGA Antibody

• Catalog number
  A00816-1
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  FGA
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human
• Analyses
  WB
• Immunogen
  A synthetic peptide corresponding to a sequence at the C-terminus of human FGA (687-727aa RTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQRGSVLRVE), different from the related mouse and rat sequences by two amino acids.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the FGA Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The FGA Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  Fibrinogen alpha chain is a protein that in humans is encoded by the FGA gene. This gene encodes the alpha subunit of the coagulation factor fibrinogen, which is a component of the blood clot. Following vascular injury, the encoded preproprotein is proteolytically processed by thrombin during the conversion of fibrinogen to fibrin. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that undergoes proteolytic processing.
• Related articles
  1. "Entrez Gene: FGA fibrinogen alpha chain". 2. Herrick S, Blanc-Brude O, Gray A, Laurent G (Jul 1999). "Fibrinogen". The International Journal of Biochemistry & Cell Biology. 31 (7): 741–746. 3. Tsurupa G, Medved L (Jan 2001). "Identification and characterization of novel tPA- and plasminogen-binding sites within fibrin(ogen) alpha C-domains". Biochemistry. 40 (3): 801–808.
• Gene Name
  FGA
• Protein Name
  Fibrinogen alpha chain
• Gene Full Name
  fibrinogen alpha chain
• Synonyms
  Ac1873 | Fba5e | FGA | Fibrinopeptide A | Fib2 | P02671
• Uniprot ID
  P02671
• Entrez GeneID
  2243
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  FGA  
• Gene symbol
  FGA
• Short name
  FGA Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  fibrinogen alpha chain (antibody to-)
• Alternative technique
  antibodies
• Alternative to gene target
  fibrinogen alpha chain, Fib2, FGA and IDBG-42099 and ENSG00000171560 and 2243, protein binding, Extracellular, Fga and IDBG-154534 and ENSMUSG00000028001 and 14161, FGA and IDBG-628958 and ENSBTAG00000001638 and 522039

Gene info

• Identity
  HGNC:3661
• Gene
  FGA
• Long gene name
  fibrinogen alpha chain
• Synonyms gene name
  • fibrinogen, A alpha polypeptide
• Locus
  4q31.3
• Discovery year
  2001-06-22
• Entrez gene record
  2243
• RefSeq identity
  • NM_000508
• Classification
  • Fibrinogen C domain containing
  • Receptor ligands
• VEGA ID
  OTTHUMG00000150330
• Locus Specific Databases
  • LRG_557

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products