Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

PPP1R8 antibody

PPP1R8 antibody is available 5 times from Fitzgerald labs

70R-4732 | PPP1R8 antibody size: 50 µg | 538.94 USD


70R-1468 | PPP1R8 antibody size: 100 µg | 441.36 USD

Catalog number 70R-1468
Supplier fitzgerald
Price441.36 USD
Size 100 µg
Area of research Signal Transduction
Type of Immunogen PPP1R8 antibodies were raised using a synthetic peptide corresponding to a region with amino acids THGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGD
Cross Reactivity Human,Mouse,Rat,Dog
Method of Purification Total IgG Protein A purified
Concentration 1 mg/ml
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PPP1R8 antibody in PBS
Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping conditions Blue Ice
Tested for WB
Usage Recommendations WB: 1.25 ug/ml
Assay Information PPP1R8 Blocking Peptide, catalog no. 33R-9105, is also available for use as a blocking control in assays to test for specificity of this PPP1R8 antibody
Additional Information This is a rabbit polyclonal antibody against PPP1R8, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at
1. Gene info
Long gene name protein phosphatase 1 regulatory subunit 8
Synonyms gene name
  • protein phosphatase 1, regulatory (inhibitor) subunit 8
  • protein phosphatase 1, regulatory subunit 8
GenBank acession
Discovery year 1998-04-29
Entrez gene record5511
Pubmed identfication
RefSeq identity
  • Protein phosphatase 1 regulatory subunits
Havana BLAST/BLATOTTHUMG00000003734
MeSH Data
Scope note:Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
Additional information

70R-4733 | PPP1R8 antibody size: 50 µg | 538.94 USD


70R-1314 | PPP1R8 antibody size: 100 µg | 441.36 USD


70R-19477 | PPP1R8 antibody size: 50 µl | 580.92 USD

Category Primary Antibody
Raised in Rabbit
Product Subtype Purified Polyclonal Antibodies
Antibody Subtype Polyclonal Antibodies, Purified
Product Type Primary Antibodies
Properties If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
French translation anticorps
Gene targetPPP1R8
Short name PPP1R8 antibody
Technique Antibody
Alternative name PPP1R8 (Antibody to)
Alternative technique antibodies
Similar products
PPP1R8 antibody Suppplier: genways
Price: 466.32 USD
PPP1R8 antibody Suppplier: SAB
Price: 486.74 USD
Rabbit PPP1R8 antibody Suppplier: fitzgerald
Price: 482.21 USD
PPP1R8, Mouse Monoclonal antibody-; Clone: 1G11 Suppplier: accurate-monoclonals
Price: 0.00 USD
PPP1R8 antibody Suppplier: MyBioSource
Price: 376.69 USD
PPP1R8 antibody region Suppplier: aviva
Price: 292.73 USD
Ajax processing
PPP1R8 antibody - fitzgerald -
Contact us
Ajax processing
Chat with employee