Recombinant Mouse RANK/TNFRSF11A (C-6His)

  • Catalog number
    CS23-10
  • Price
    Please ask
  • Size
    10 ug
  • Description
    Recombinant Mouse Receptor Activator of NF-kappa B is produced by our Mammalian expression system and the target gene encoding Val31-Ser214 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Mouse
  • Origin
    Human cells
  • Peptide sequence
    VTPPCTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCTLLGKLEAHQGTTESDVVCSSSMTLRRPPKEAQAYLPSVDHHHHHH
  • Estimated molecular weight
    21.3
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    O35305
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    TNFRSF11A, ANKFY1
  • Short name
    Recombinant Mouse RANK/TNFRSF11A (C-6His)
  • Technique
    Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Species
    Mouse, Mouses
  • Alternative name
    Recombinant Mouse RANK (C-6His)
  • Alternative technique
    rec, murine
  • Alternative to gene target
    tumor necrosis factor receptor superfamily, member 11a, NFKB activator, CD265 and FEO and LOH18CR1 and ODFR and OFE and OPTB7 and OSTS and PDB2 and RANK and TRANCER, TNFRSF11A and IDBG-4279 and ENSG00000141655 and 8792, metal ion binding, Cell surfaces, Tnfrsf11a and IDBG-185529 and ENSMUSG00000026321 and 21934, TNFRSF11A and IDBG-644974 and ENSBTAG00000007569 and 530884
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee