HELLS antibody

• Catalog number
  70R-4647
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  DNA & RNA
• Type of Immunogen
  HELLS antibodies were raised using the middle region of HELLS corresponding to a region with amino acids QSGLNLSKNFLDPKELMELLKSRDYEREIKGSREKVISDKDLELLLDRSD
• Raised in
  Rabbit
• Specificity
  HELLS antibody was raised against the middle region of HELLS
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HELLS antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  HELLS Blocking Peptide, catalog no. 33R-7725, is also available for use as a blocking control in assays to test for specificity of this HELLS antibody
• Additional Information
  This is a rabbit polyclonal antibody against HELLS, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  HELLS  
• Gene symbol
  HELLS
• Short name
  HELLS antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal HELLS antibody raised against the middle region of HELLS
• Alternative technique
  antibodies
• Alternative to gene target
  helicase, lymphoid-specific, LSH and PASG and SMARCA6, HELLS and IDBG-83141 and ENSG00000119969 and 3070, hydrolase activity, nuclei, Hells and IDBG-163438 and ENSMUSG00000025001 and 15201, HELLS and IDBG-637847 and ENSBTAG00000005979 and 540933

Gene info

• Identity
  HGNC:4861
• Gene
  HELLS
• Long gene name
  helicase, lymphoid specific
• Synonyms
  • PASG
  • SMARCA6
  • LSH
  • Nbla10143
• Synonyms name
  • SWI/SNF2-related, matrix-associated, actin-dependent regulator of chromatin, subfamily A, member 6
  • proliferation-associated SNF2-like protein
• GenBank acession
  • AF155827
• Locus
  10q23.33
• Discovery year
  1998-07-15
• Entrez gene record
  3070
• Pubmed identfication
  • 9878251
  • 10910076
• RefSeq identity
  • NM_018063
• Classification
  • DNA helicases
• VEGA ID
  OTTHUMG00000018793

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products