Recombinant Equine IL-1 Receptor Antagonist

  • Catalog number
    RP0428E-025
  • Price
    Please ask
  • Size
    25 ug
  • Product Type
    Protein
  • Target
    IL-1ra
  • Alias
    IL-1F3
  • MW
    17.4 kDa
  • Form
    Lyophilized
  • Storage
    -20 °C
  • Shipping
    Ambient
  • Entrez Gene ID
    100034236
  • Protein Sequence
    HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ (152)
  • Source
    Yeast
  • Description
    The antagonist receptor ligand binding will be in contrast with agonist activity. kingfisherbiotech produces more antagonist and receptor related products as 1. The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
  • Gene
    The Interleukin-1 family (IL-1 family) is a group of 11 cytokines, which plays a central role in the regulation of immune and inflammatory responses to infections or sterile insults. Rec. E. coli interleukin-1 for cell culture or antibody production.
  • Additional source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    IL1A, IL1B, IL1F10, IL36B, IL36A, IL19, IL17F, IL36G, IL25, IL22
  • Short name
    Recombinant Equine IL-1 Receptor Antagonist
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. kingfisherbiotech advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Equine
  • Alternative name
    Rec. horse Interleukin-1 Receptor Antagonist
  • Alternative technique
    rec
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee