Recombinant Mouse OX40/TNFRSF4/CD134 (C-6His)

• Catalog number
  CK54-500
• Price
  Please ask
• Size
  500 ug

• Description
  Recombinant Mouse OX40 is produced by our Mammalian expression system and the target gene encoding Val20-Pro211 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Mouse
• Origin
  Human cells
• Peptide sequence
  VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGPHHHHHH
• Estimated molecular weight
  22,1 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  P47741
• Other related products
• Test
  Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
• Latin name
  Mus musculus
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  OX40/TNFRSF4/CD134   C-6His  
• Gene symbol
  TNFRSF4
• Short name
  Recombinant Mouse OX40/TNFRSF4/CD134 (C-6His)
• Technique
  Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  mouse
• Species
  Mouse, Mouses
• Alternative name
  Mouse OX40/TNFRSF4/CD134(C-6His)
• Alternative technique
  rec, murine
• Alternative to gene target
  tumor necrosis factor receptor superfamily, member 4, ACT35 and CD134 and IMD16 and OX40 and TXGP1L, TNFRSF4 and IDBG-84605 and ENSG00000186827 and 7293, protein binding, Cell surfaces, Tnfrsf4 and IDBG-208242 and ENSMUSG00000029075 and 22163, TNFRSF4 and IDBG-635323 and ENSBTAG00000015635 and 528782

Gene info

• Identity
  HGNC:11918
• Gene
  TNFRSF4
• Long gene name
  TNF receptor superfamily member 4
• Synonyms gene
  • TXGP1L
• Synonyms gene name
  • tumor necrosis factor receptor superfamily, member 4
• Synonyms
  • ACT35
  • OX40
  • CD134
• GenBank acession
  • X75962
• Locus
  1p36.33
• Discovery year
  1994-12-15
• Entrez gene record
  7293
• Pubmed identfication
  • 7510240
  • 2828930
• Classification
  • Tumor necrosis factor receptor superfamily
  • CD molecules
• VEGA ID
  OTTHUMG00000001415
• Locus Specific Databases
  • LRG_1319

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products