RPS6KA2 antibody

  • Catalog number
    70R-5759
  • Price
    Please ask
  • Size
    50 µg
  • Category
    Primary Antibody
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Area of research
    Cell Biology
  • Type of Immunogen
    RPS6KA2 antibodies were raised using the middle region of RPS6KA2 corresponding to a region with amino acids LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR
  • Raised in
    Rabbit
  • Specificity
    RPS6KA2 antibody was raised against the middle region of RPS6KA2
  • Cross Reactivity
    Human,Mouse,Rat
  • Method of Purification
    Affinity purified
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPS6KA2 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB
  • Usage Recommendations
    WB: 1 ug/ml
  • Assay Information
    RPS6KA2 Blocking Peptide, catalog no. 33R-5450, is also available for use as a blocking control in assays to test for specificity of this RPS6KA2 antibody
  • Additional Information
    This is a rabbit polyclonal antibody against RPS6KA2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
  • URL
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    RPS6KA2  
  • Gene symbol
    RPS6KA2-AS1, RPS6KA2-IT1, RPS6KA2
  • Short name
    RPS6KA2 antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    Rabbit polyclonal RPS6KA2 antibody raised against the middle region of RPS6KA2
  • Alternative technique
    antibodies
  • Alternative to gene target
    ribosomal protein S6 kinase, 90kDa, polypeptide 2, HU-2 and MAPKAPK1C and p90-RSK3 and pp90RSK3 and RSK and RSK3 and S6K-alpha and S6K-alpha2, RPS6KA2 and IDBG-98954 and ENSG00000071242 and 6196, transferase activity, nuclei, Rps6ka2 and IDBG-134649 and ENSMUSG00000023809 and 20112, RPS6KA2 and IDBG-635849 and ENSBTAG00000021741 and 517953
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    RPS6KA2 intronic transcript 1
  • Synonyms gene name
    • RPS6KA2 intronic transcript 1 (non-protein coding)
  • Locus
  • Discovery year
    2011-05-24
  • Classification
    • Intronic transcripts
  • VEGA ID
Gene info
  • Identity
  • Gene
  • Long gene name
    ribosomal protein S6 kinase A2
  • Synonyms gene name
    • ribosomal protein S6 kinase, 90kD, polypeptide 2
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1994-07-11
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • MicroRNA protein coding host genes
    • AGC family kinases
    • MAPK activated protein kinases
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee