Recombinant Mouse Syndecan-Binding Protein 1/Syntenin-1/SDCBP (C-6His)

• Catalog number
  C776-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Mouse Syntenin-1 is produced by our E.coli expression system and the target gene encoding Ser2-Val299 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Mouse
• Origin
  Escherichia coli
• Peptide sequence
  MSLYPSLEDLKVDKVIQAQTAYSANPASQAFVLVDASAALPPDGNLYPKLYPELSQYMGLSLNEAEICESMPMVSGAPAQGQLVARPSSVNYMVAPVTGNDAGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAARNGLLTDHHICEINGQNVIGLKDAQIADILSTAGTVVTITIMPTFIFEHIIKRMAPSIMKSLMDHTIPEVLEHHHHHH
• Estimated molecular weight
  33,4 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  O08992
• Other related products
• Test
  Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
• Latin name
  Mus musculus
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Syndecan-Binding   Protein   1/Syntenin-1/SDCBP   C-6His  
• Gene symbol
  SDCBP
• Short name
  Recombinant Mouse Syndecan-Binding Protein 1/Syntenin-1/SDCBP (C-6His)
• Technique
  Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  mouse
• Species
  Mouse, Mouses
• Alternative name
  Mouse Syntenin-1/SDCBP(C-6His)
• Alternative technique
  rec, murine
• Alternative to gene target
  syndecan binding protein (syntenin), MDA-9 and MDA9 and ST1 and SYCL and TACIP18, SDCBP and IDBG-22706 and ENSG00000137575 and 6386, cell adhesion molecule binding, nuclei, Sdcbp and IDBG-128595 and ENSMUSG00000028249 and 53378, SDCBP and IDBG-644487 and ENSBTAG00000019910 and 510979

Gene info

• Identity
  HGNC:10662
• Gene
  SDCBP
• Long gene name
  syndecan binding protein
• Synonyms
  • SYCL
  • MDA-9
• Synonyms name
  • syntenin
  • syntenin-1
• GenBank acession
  • AF000652
• Locus
  8q12.1
• Discovery year
  1998-02-11
• Entrez gene record
  6386
• Pubmed identfication
  • 9391086
• RefSeq identity
  • NM_005625
• Classification
  • PDZ domain containing
• VEGA ID
  OTTHUMG00000164303

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products