Recombinant Human Protein CutA (C-6His)
-
Catalog number
C255-500
-
Price
Please ask
-
Size
500 ug
-
-
Description
Recombinant Human Protein CutA is produced by our E.coli expression system and the target gene encoding Met1-Pro156 is expressed with a 6His tag at the C-terminus.
-
Species reactivity
Human
-
Origin
Escherichia coli
-
Peptide sequence
MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLPLEHHHHHH
-
Estimated molecular weight
17,9 kDa
-
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
-
Shipping condition
Ambient/Room Temperature
-
Package form
Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0.
-
Storage conditions
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
-
Reconstitution conditions
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
-
UniProt number
O60888
-
-
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
Source
Recombinants or rec. proteins
-
Group
recombinants
-
Gene target
-
Short name
Recombinant Protein CutA (C-6His)
-
Technique
Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
-
Species
Human, Humans
-
Alternative name
Human Protein CutA(C-6His)
-
Alternative technique
rec
-
Alternative to gene target
cutA divalent cation tolerance homolog (E. coli), CUTA and IDBG-82867 and ENSG00000112514 and 51596, enzyme binding, Plasma membranes, Cuta and IDBG-155956 and ENSMUSG00000024194 and 67675, CUTA and IDBG-629060 and ENSBTAG00000001635 and 508956
-
MeSH Data
-
Name
-
Concept
Scope note:
The initial culturing of cells derived directly from fresh TISSUES.
-
Tree numbers
- E01.370.225.500.223.500
- E05.200.500.265.500
- E05.242.223.500
- E05.481.500.249.500
-
Qualifiers
ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products