Recombinant Human Lactadherin(MFGE8)

  • Catalog number
    RPC20059
  • Price
    Please ask
  • Size
    1 mg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    Q08431
  • Gene number
    MFGE8
  • Other name
    Breast epithelial antigen BA46HMFGMFGMMilk fat globule-EGF factor 8 ; MFG-E8SED1
  • Protein origin
    E.coli
  • Protein region
    24-387aa
  • Protein sequence
    LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC
  • Information about sequence
    Full Length
  • Expected molecular weight
    56.8kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    MFGE8
  • Short name
    Recombinant Lactadherin(MFGE8)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Species
    Human, Humans
  • Alternative name
    Rec. H. sapiens Lactadherin(milk fat globule-epidermal growth factor factor 8 protein)
  • Alternative technique
    rec
  • Alternative to gene target
    milk fat globule-EGF factor 8 protein, BA46 and EDIL1 and HMFG and hP47 and HsT19888 and MFG-E8 and MFGM and OAcGD3S and SED1 and SPAG10, MFGE8 and IDBG-28947 and ENSG00000140545 and 102723860,102724554,4240, phosphatidylethanolamine binding, Extracellular, Mfge8 and IDBG-193646 and ENSMUSG00000030605 and 17304, MFGE8 and IDBG-629001 and ENSBTAG00000003300 and 281913
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee