Recombinant Mouse Complement Component C5

• Catalog number
  C075-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Mouse Complement Component C5 is produced by our E.coli expression system and the target gene encoding Asn679-Arg755 is expressed.
• Species reactivity
  Mouse
• Origin
  Escherichia coli
• Peptide sequence
  MNLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR
• Estimated molecular weight
  9 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB, 350mM NaCl, pH 7.5.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  P06684
• Other related products
• Test
  Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
• Latin name
  Mus musculus
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Complement   Component  
• Gene symbol
  C5
• Short name
  Recombinant Mouse Complement Component C5
• Technique
  Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  mouse
• Species
  Mouse, Mouses
• Alternative name
  Mouse Complement Component C5/C5
• Alternative technique
  rec, murine
• Alternative to gene target
  complement component 5, C5a and C5b and C5D and CPAMD4 and ECLZB, C5 and IDBG-83167 and ENSG00000106804 and 727, C5a anaphylatoxin chemotactic receptor binding, Extracellular, Hc and IDBG-163835 and ENSMUSG00000026874 and 15139, BT.24055 and IDBG-638834 and ENSBTAG00000012210 and 512045

Gene info

• Identity
  HGNC:1331
• Gene
  C5
• Long gene name
  complement C5
• Synonyms gene name
  • complement component 5
• Synonyms
  • CPAMD4
  • C5a
  • C5b
• Synonyms name
  • prepro-C5
  • C5a anaphylatoxin
• GenBank acession
  • M57729
• Locus
  9q33.2
• Discovery year
  2001-06-22
• Entrez gene record
  727
• RefSeq identity
  • NM_001735
• Classification
  • C3 and PZP like, alpha-2-macroglobulin domain containing
  • Complement system activation components
  • Receptor ligands
• VEGA ID
  OTTHUMG00000020579
• Locus Specific Databases
  • C5base: Mutation registry for C5 deficiency
  • LRG_28

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products