Recombinant Human Myelin Oligodendrocyte Glycoprotein/MOG
-
Catalog number
C051-1000
-
Price
Please ask
-
Size
1 mg
-
-
Description
Recombinant Human Myelin Oligodendrocyte Glycoprotein is produced by our E.coli expression system and the target gene encoding Gly30-Gly154 is expressed with a 6His tag at the C-terminus.
-
Species reactivity
Human
-
Origin
Escherichia coli
-
Peptide sequence
MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH
-
Estimated molecular weight
15,2 kDa
-
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
-
Shipping condition
Ambient/Room Temperature
-
Package form
Lyophilized from a 0.2 µm filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 4.5.
-
Storage conditions
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
-
Reconstitution conditions
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
-
UniProt number
Q16653
-
-
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
Source
Recombinants or rec. proteins
-
Group
recombinants
-
Gene target
-
Gene symbol
MOG
-
Short name
Recombinant Myelin Oligodendrocyte Glycoprotein/MOG
-
Technique
Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
-
Species
Human, Humans
-
Alternative name
Human Myelin Oligodendrocyte Glycoprotein/MOG(E.coli,C-6His)
-
Alternative technique
rec
-
Alternative to gene target
myelin oli this GO dendrocyte glycoprotein, BTN6 and BTNL11 and MOGIG2 and NRCLP7, MOG and IDBG-73515 and ENSG00000204655 and 4340, protein binding, Plasma membranes, Mog and IDBG-182135 and ENSMUSG00000076439 and 17441, MOG and IDBG-635109 and ENSBTAG00000017818 and 280863
-
Gene info
MeSH Data
-
Name
-
Concept
Scope note:
The initial culturing of cells derived directly from fresh TISSUES.
-
Tree numbers
- E01.370.225.500.223.500
- E05.200.500.265.500
- E05.242.223.500
- E05.481.500.249.500
-
Qualifiers
ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products