Recombinant Human Caspase-3(CASP3),partial

  • Catalog number
    RPC20183
  • Price
    Please ask
  • Size
    100 μg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    P42574
  • Gene number
    CASP3
  • Other name
    Apopain; Cysteine protease CPP32 ; CPP-32; Protein Yama; SREBP cleavage activity 1 ; SCA-1
  • Protein origin
    E.coli
  • Protein region
    29-175aa
  • Protein sequence
    SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
  • Information about sequence
    Partial
  • Expected molecular weight
    20.7kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    Human and some mouse caspases are active in apoptosis and cell death and even in necrosis and inflammation. CASP Gene and orthologous enzymes have been identifies successfully in the signal transduction cascade and pathways.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    CASP3
  • Short name
    Recombinant Caspase-3(CASP3),partial
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-tagged
  • Species
    Human, Humans
  • Alternative name
    Rec. H. sapiens caspase-3(caspase 3, apoptosis-related cysteine peptidase),partial
  • Alternative technique
    rec
  • Alternative to gene target
    caspase 3, apoptosis-related cysteine peptidase, CPP32 and CPP32B and SCA-1, CASP3 and IDBG-46394 and ENSG00000164305 and 836, cysteine-type endopeptidase activity involved in execution phase of apoptosis, nuclei, Casp3 and IDBG-154306 and ENSMUSG00000031628 and 12367, CASP3 and IDBG-628521 and ENSBTAG00000015874 and 408016
Gene info
  • Identity
  • Gene
  • Long gene name
    caspase 3
  • Synonyms gene name
    • caspase 3, apoptosis-related cysteine protease
    • caspase 3, apoptosis-related cysteine peptidase
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1996-07-22
  • Entrez gene record
    836
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Caspases
    • Small nucleolar RNA protein coding host genes
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Theoretical representations that simulate the behavior or activity of chemical processes or phenomena; includes the use of mathematical equations, computers, and other electronic equipment.
  • Tree numbers
    • E05.599.495
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee